BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30045 (673 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC056415-1|AAH56415.1| 631|Homo sapiens RPAP3 protein protein. 48 2e-05 AK025561-1|BAB15170.1| 665|Homo sapiens protein ( Homo sapiens ... 48 2e-05 AK124189-1|BAC85798.1| 282|Homo sapiens protein ( Homo sapiens ... 30 6.6 >BC056415-1|AAH56415.1| 631|Homo sapiens RPAP3 protein protein. Length = 631 Score = 48.4 bits (110), Expect = 2e-05 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = -1 Query: 430 PVNSVQFMSQWKYLKGQDEVRSYYLSIIEPSRIPSMFANALESDVLSELIRALHD 266 P NS Q S ++ LK ++ YL IEPS P +F L+ DV +++++ LHD Sbjct: 512 PANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHD 566 Score = 30.3 bits (65), Expect = 6.6 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = -3 Query: 227 LTALTQVKRFSALAMFLSATDKRHLKNLLEYCRNEEKCSEQDIAELTEKY 78 L L+++KRF MF+S T+K+ + L + ++ + + EL ++Y Sbjct: 581 LQRLSELKRFDMAVMFMSETEKKIARALFNHI-DKSGLKDSSVEELKKRY 629 >AK025561-1|BAB15170.1| 665|Homo sapiens protein ( Homo sapiens cDNA: FLJ21908 fis, clone HEP03830. ). Length = 665 Score = 48.4 bits (110), Expect = 2e-05 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = -1 Query: 430 PVNSVQFMSQWKYLKGQDEVRSYYLSIIEPSRIPSMFANALESDVLSELIRALHD 266 P NS Q S ++ LK ++ YL IEPS P +F L+ DV +++++ LHD Sbjct: 546 PANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHD 600 Score = 30.3 bits (65), Expect = 6.6 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = -3 Query: 227 LTALTQVKRFSALAMFLSATDKRHLKNLLEYCRNEEKCSEQDIAELTEKY 78 L L+++KRF MF+S T+K+ + L + ++ + + EL ++Y Sbjct: 615 LQRLSELKRFDMAVMFMSETEKKIARALFNHI-DKSGLKDSSVEELKKRY 663 >AK124189-1|BAC85798.1| 282|Homo sapiens protein ( Homo sapiens cDNA FLJ42195 fis, clone THYMU2033787. ). Length = 282 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 433 PPVSAHPSPWPLPPISTSPTQD*ICPC 513 PP + P PWP + SP CPC Sbjct: 67 PPTVSFPPPWPTHHVLPSPVAHPPCPC 93 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,319,004 Number of Sequences: 237096 Number of extensions: 1762786 Number of successful extensions: 6216 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6208 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7647512560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -