BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30044 (380 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY507107-1|AAS87021.1| 1043|Homo sapiens NMDA receptor subunit 3... 34 0.18 AC004528-2|AAC12680.1| 901|Homo sapiens R32184_2 protein. 31 1.2 >AY507107-1|AAS87021.1| 1043|Homo sapiens NMDA receptor subunit 3B protein. Length = 1043 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = -2 Query: 223 LGVENATLTHMG*FHTYTLQLISRVGSGARVNVFAASSGRVSKTVNTRPP 74 LG+ +A L+ +G H + Q + R+ G+R+ + +S ++ + +NT PP Sbjct: 840 LGLGSALLSSLG-EHAFFRQALPRIRKGSRLQYWLHTSQKIHRALNTEPP 888 >AC004528-2|AAC12680.1| 901|Homo sapiens R32184_2 protein. Length = 901 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = -2 Query: 223 LGVENATLTHMG*FHTYTLQLISRVGSGARVNVFAASSGRVSKTVNTRPP 74 LG+ +A L+ +G H + + R+ G+R+ + +S ++ + +NT PP Sbjct: 840 LGLGSALLSSLG-EHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPP 888 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,743,005 Number of Sequences: 237096 Number of extensions: 744595 Number of successful extensions: 1267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2526356360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -