BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30044 (380 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 4.9 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 6.5 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 4.9 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +3 Query: 102 TRPLLAANTLTRAPLPTREINCSVYV*NYPM*VRVAFSTPRWITVYFLDL 251 T PLL L L T + ++ V N V RW+ V F+ + Sbjct: 295 TVPLLGKYLLFTMVLVTLSVVVTIAVLNVNFRSPVTHRMARWVRVVFIQV 344 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 20.6 bits (41), Expect = 6.5 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 81 RVLTVFDTRPLLAANTLTRAPLPTREINCS 170 RV D P NT++ P P R + S Sbjct: 37 RVAEEVDPLPFGVENTISSVPQPPRSLEGS 66 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,230 Number of Sequences: 438 Number of extensions: 1970 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -