BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30043 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 22 6.0 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 7.9 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 7.9 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = -3 Query: 673 GHQTPHLLEPSMCMSCGVQVHRGGTCP*QCSMVRPFYGITLAGREPAQWD 524 G TP E S V G P + ++ FYG T +PAQ D Sbjct: 224 GADTPWQREYENVNSTVVNWVNAGADPGKLTIGLAFYGHTFQLADPAQHD 273 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.4 bits (43), Expect = 7.9 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 538 VLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLALTNVESG 669 VLF+ + +GV Y ++ G+SR + + T LAL ++ G Sbjct: 33 VLFVIIVAGNVGVLYTLLFGRSRKSRMNY--FITHLALADLSVG 74 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 428 TKEAQHHPIRHKHSHQA 478 TK HH I+ +H HQ+ Sbjct: 101 TKFNPHHEIKLQHLHQS 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,199 Number of Sequences: 336 Number of extensions: 3762 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -