BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30040 (602 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 25 1.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 1.4 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.4 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 4.4 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 25.4 bits (53), Expect = 1.4 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 498 GVHGNIQTLYTLCNKNKMAQVSALNQRW*VSNFD 397 G G +Q +T+ +M ++S+ RW +FD Sbjct: 220 GRRGPLQAAFTIKELREMLKLSSCTTRWRADDFD 253 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.4 bits (53), Expect = 1.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 275 TDCVRSNICHNREFSRAV 222 TDC ++CH RE ++++ Sbjct: 2328 TDCTNPSLCHGREGTKSI 2345 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.4 bits (53), Expect = 1.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 275 TDCVRSNICHNREFSRAV 222 TDC ++CH RE ++++ Sbjct: 2338 TDCTNPSLCHGREGTKSI 2355 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 396 DQNSIPTN--ADSTRTPVPFYFCC 461 DQ S +N +T TP +FCC Sbjct: 122 DQESCSSNECVSTTETPTRHFFCC 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,273 Number of Sequences: 2352 Number of extensions: 11204 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -