BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30039 (644 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.8 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 2.8 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 5.0 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 6.6 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 6.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 8.7 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 351 GLPTPVAGSLMMKIFVGV 404 GL + + G +MM +FVGV Sbjct: 947 GLISAIYGLIMMAVFVGV 964 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 351 GLPTPVAGSLMMKIFVGV 404 GL + + G +MM +FVGV Sbjct: 947 GLISAIYGLIMMAVFVGV 964 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 106 TQSPIAAGIIFIFYHLLMTITSHYLSSL 189 T +A +IFI +H++ T + +L L Sbjct: 241 TIETVAYSVIFILWHIVGTFSGIFLCDL 268 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 575 VECFVXKQYRSWFKLSWPSL 634 ++ F +Q+RSW S P L Sbjct: 224 IDSFTLEQHRSWCSSSQPVL 243 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 268 GSVVIRNIHKNHCR 227 GS +I H+N CR Sbjct: 80 GSCIIDKTHRNQCR 93 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 268 GSVVIRNIHKNHCR 227 GS +I H+N CR Sbjct: 80 GSCIIDKTHRNQCR 93 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 164 LRHIIYPLFHTIVLFSILIYKSTVVFM 244 L+ + Y + IVL S +I K T++FM Sbjct: 70 LKIVAYLVTFVIVLGSGVISKGTLLFM 96 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 164 LRHIIYPLFHTIVLFSILIYKSTVVFM 244 L+ + Y + IVL S +I K T++FM Sbjct: 70 LKIVAYLVTFVIVLGSGVISKGTLLFM 96 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 164 LRHIIYPLFHTIVLFSILIYKSTVVFM 244 L+ + Y + IVL S +I K T++FM Sbjct: 70 LKIVAYLVTFVIVLGSGVISKGTLLFM 96 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 164 LRHIIYPLFHTIVLFSILIYKSTVVFM 244 L+ + Y + IVL S +I K T++FM Sbjct: 70 LKIVAYLVTFVIVLGSGVISKGTLLFM 96 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 163 ITSHYLSSLPHNSPLFYTNI*IYSGFYGCSV*LLNHVSD*LE-TWYP 300 ++ HY++ P +PLF + G ++ + V D L W P Sbjct: 413 VSPHYVTPTPPEAPLFQNVLPPIGGMMNWNMPSTSVVGDMLNMNWNP 459 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,872 Number of Sequences: 336 Number of extensions: 3907 Number of successful extensions: 15 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -