BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30039 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces... 28 1.3 SPAC13D6.03c |||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 27 1.8 SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomy... 26 4.0 SPBC15D4.07c |atg9|apg9|autophagy associated protein Atg9 |Schiz... 26 4.0 SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 26 5.3 SPBC19C7.12c |||alpha-1,2-mannosyltransferase|Schizosaccharomyce... 25 7.1 SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF... 25 9.3 >SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1441 Score = 27.9 bits (59), Expect = 1.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 Query: 333 NIYMSVGLPTPVAGSLMM 386 +IY SV +PTP+ GSL++ Sbjct: 293 DIYASVSIPTPLGGSLLL 310 >SPAC13D6.03c |||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 228 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 437 EGTGTASII*FQRYVNLFNKRKYTLLLICILNYIISLNFKKCYWWIV 577 +G A I +QRY +LF K + L+ I+ + + WW++ Sbjct: 178 KGHDPAENIAYQRYYHLFRKGELNELVETAGGSILEHGYDRDNWWVI 224 >SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 396 Score = 26.2 bits (55), Expect = 4.0 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 179 YPLFHTIVLFSILIYKSTVVFMDVPY 256 YP + T+ + + +S++ F VPY Sbjct: 267 YPTYQTVYQIGVFLSRSSISFFTVPY 292 >SPBC15D4.07c |atg9|apg9|autophagy associated protein Atg9 |Schizosaccharomyces pombe|chr 2|||Manual Length = 702 Score = 26.2 bits (55), Expect = 4.0 Identities = 10/37 (27%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 85 IPRTDCATQ-SPIAAGIIFIFYHLLMTITSHYLSSLP 192 + ++ C Q SPI ++++F L+ + +YL+ +P Sbjct: 241 VTKSQCIAQMSPITYLVLWLFLSFLLALWIYYLTDIP 277 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 25.8 bits (54), Expect = 5.3 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 133 IFIFYHLLMTITSHYLSSLPHNSPLFYTNI*I-YSGFYG 246 I+I+ LL+T L + PH SP FY ++ I YS G Sbjct: 586 IWIYASLLVTCFVLALGNRPHGSPNFYLSMVIMYSILMG 624 >SPBC19C7.12c |||alpha-1,2-mannosyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 390 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 479 VNLFNKRKYTLLLICILNYIISLNFKKCY 565 V L K K LLL+ +L ++ + FKK Y Sbjct: 2 VRLPRKFKRVLLLVVLLTLVVFVRFKKQY 30 >SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF|Schizosaccharomyces pombe|chr 3|||Manual Length = 892 Score = 25.0 bits (52), Expect = 9.3 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 164 LRHI-IYPLFHTIVLFSILIYKSTVVFMDV 250 LRH+ IYP FH +V S+ + VV ++V Sbjct: 180 LRHVFIYPRFHVVVAESLEKSPANVVELNV 209 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,812,495 Number of Sequences: 5004 Number of extensions: 61180 Number of successful extensions: 141 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -