BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30037 (515 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 69 3e-13 SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 69 3e-13 SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 65 7e-12 SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosacchar... 27 2.2 SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 8.9 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 8.9 SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe... 25 8.9 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 69.3 bits (162), Expect = 3e-13 Identities = 31/61 (50%), Positives = 46/61 (75%) Frame = +3 Query: 72 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 251 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLL 60 Query: 252 N 254 N Sbjct: 61 N 61 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 69.3 bits (162), Expect = 3e-13 Identities = 31/61 (50%), Positives = 46/61 (75%) Frame = +3 Query: 72 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 251 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLL 60 Query: 252 N 254 N Sbjct: 61 N 61 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 64.9 bits (151), Expect = 7e-12 Identities = 28/61 (45%), Positives = 45/61 (73%) Frame = +3 Query: 72 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 251 +S +ELA Y+ALIL D+ + +T +K+ ++ KA V+VEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYAALILADEGIEITSDKLLSLTKAGNVEVEPIWATIFAKALEGKDLKELLL 60 Query: 252 N 254 N Sbjct: 61 N 61 >SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosaccharomyces pombe|chr 1|||Manual Length = 186 Score = 26.6 bits (56), Expect = 2.2 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Frame = +3 Query: 54 RSKLKMVSKAELACVYSALILVD-DDV--AVTGEKISTILKAAAVDVEPYWPGLFAKALE 224 R+ L+ + E S L+L + DV A++ E+IS IL + +W AL Sbjct: 103 RNTLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKILNISKYK-SSHWRIFSVSALT 161 Query: 225 GINVRDLIT 251 G+N++D I+ Sbjct: 162 GLNIKDAIS 170 >SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 36 GLRQLARSKLKMVSKAELACVYSAL 110 G+ QL + ++SKA+L C Y L Sbjct: 159 GMLQLDMPHVNILSKADLLCTYGTL 183 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 24.6 bits (51), Expect = 8.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 243 GHGH*CLPRLWRTDL 199 G+G CLP LWR D+ Sbjct: 402 GNGVQCLPLLWRQDI 416 >SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 24.6 bits (51), Expect = 8.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -3 Query: 246 SGHGH*CLPRLWRTDLANMALHLQPPLSRWWKFSHQ 139 SGHG P L + + M L+ PL + W++ + Sbjct: 357 SGHGFKFFPILGKYSIGCMFRELEEPLLKKWRWKKE 392 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,566,057 Number of Sequences: 5004 Number of extensions: 25441 Number of successful extensions: 83 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -