BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30036 (575 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 26 1.0 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 25 1.3 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 5.4 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 23 9.4 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 23 9.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.4 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 25.8 bits (54), Expect = 1.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 412 AREAVRHFGPAPGAPRSHTKPYV 480 A E +R + PAP R+ TKPY+ Sbjct: 387 ANETLRKWTPAPFLDRTCTKPYM 409 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -3 Query: 252 LTSFVTVPTTTAIKPSRVGFFMWLAKRDTEIGGRLIRLIKSRRRTI 115 LT F+ + + T +RVG +W +K E R + IKS+RR + Sbjct: 252 LTYFLPIGSMTYTY-ARVGLELWGSKSIGECTQRQLDNIKSKRRVV 296 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.4 bits (48), Expect = 5.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 280 PPSSSVSCTSHVICDCP 230 PPS S T +I DCP Sbjct: 146 PPSFLTSLTKGIITDCP 162 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 425 CVTLALLQEHRALTLNPMFAPRDMKKQGQ 511 C Q HR + +P F+PR GQ Sbjct: 18 CAEAQANQRHRLVRPSPSFSPRPRYAVGQ 46 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 425 CVTLALLQEHRALTLNPMFAPRDMKKQGQ 511 C Q HR + +P F+PR GQ Sbjct: 18 CAEAQANQRHRLVRPSPSFSPRPRYAVGQ 46 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 400 LVPVLSSCQSEHEEPADQK*EFLLQQPKCVHELF 299 ++P + Q EH+ PA Q+ LLQQ + L+ Sbjct: 1322 IIPDMDLQQMEHQTPAQQQ---LLQQGAACNVLY 1352 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,328 Number of Sequences: 2352 Number of extensions: 12340 Number of successful extensions: 34 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -