BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30035X (555 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1554 + 27659995-27660093,27661084-27661120,27661204-276612... 29 1.9 01_01_0588 + 4372877-4372949,4374328-4376262,4376940-4377015,437... 29 2.5 10_08_0558 + 18756797-18756887,18757189-18757262,18759881-187600... 28 4.4 07_01_0278 + 2039873-2039896,2040342-2040407,2040842-2040903,204... 28 5.8 07_03_0029 - 12614394-12614984,12617973-12618005,12618362-12618370 27 7.6 >07_03_1554 + 27659995-27660093,27661084-27661120,27661204-27661280, 27662272-27662342,27662512-27662590,27662726-27662828, 27662963-27663082,27663180-27663257,27663416-27663471, 27663588-27663657,27664179-27664266,27664503-27664800, 27664943-27665158,27665521-27665841,27666054-27666103, 27666493-27666553,27666633-27666716,27666926-27667039, 27667134-27667300,27667559-27667628,27668328-27668507, 27668619-27668807 Length = 875 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 532 YNRRV*IIESTLDELNSALDFLERKNDDIHQQLKEL 425 Y R+ + STL EL + LDF + + + +QL L Sbjct: 817 YGRQAPVASSTLVELTTRLDFFKERRSQLMEQLHSL 852 >01_01_0588 + 4372877-4372949,4374328-4376262,4376940-4377015, 4378900-4378970,4379038-4379144,4379241-4379711, 4379791-4379976,4380132-4380425,4380820-4381434, 4382219-4382615,4382768-4382850,4383397-4383567, 4384046-4384243,4384754-4385314,4385401-4385460, 4385553-4385869,4385980-4386403,4386539-4387006, 4387093-4387209,4387306-4387427,4387506-4388247, 4388453-4388485,4388625-4388879,4388975-4389160, 4390115-4390453,4391293-4392045 Length = 3017 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -3 Query: 493 ELNSALDFLERKNDDIHQQLKELLQSNI--AIRQEMREENK 377 E A+ LER DDI L++L+Q + +R+++ EE K Sbjct: 913 ETGLAVATLERLGDDIESDLRQLMQGTVRRLLRRQIAEEMK 953 >10_08_0558 + 18756797-18756887,18757189-18757262,18759881-18760069, 18760190-18760309,18760457-18760521,18760684-18760828, 18761304-18763337,18763904-18764025,18764127-18764309, 18764635-18764690,18765086-18765141 Length = 1044 Score = 28.3 bits (60), Expect = 4.4 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 7/53 (13%) Frame = -3 Query: 505 STLDELNSALDFLERKNDDIHQQLKELLQSN----IAIR--QEMREE-NKDVS 368 S ++EL L + N D+H QL+++ +SN +A++ EM E+ NK++S Sbjct: 421 SQIEELKQELGHEKNLNGDLHLQLQKMQESNSELLLAVKDLDEMLEQKNKEIS 473 >07_01_0278 + 2039873-2039896,2040342-2040407,2040842-2040903, 2042839-2043067,2043787-2044014,2044177-2044469, 2044594-2044909 Length = 405 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = -3 Query: 499 LDELNSALDFLERKNDDIHQQLKELLQSNIAIRQ 398 LD+L ++ L K+D++HQ L+++ + IR+ Sbjct: 120 LDDLTIMMETLRVKDDELHQLLQDIRARDATIRE 153 >07_03_0029 - 12614394-12614984,12617973-12618005,12618362-12618370 Length = 210 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -3 Query: 508 ESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 377 +S LD+L + ++K D + Q+ ELL IRQEM E + Sbjct: 122 KSKLDKLIVGPESSQKKLDKLKQKESELLAQLEQIRQEMASEQQ 165 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,858,098 Number of Sequences: 37544 Number of extensions: 181008 Number of successful extensions: 391 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -