BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30035X (555 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50309-7|AAG24132.1| 1974|Caenorhabditis elegans Hypothetical pr... 31 0.74 Z68119-8|CAA92197.2| 1947|Caenorhabditis elegans Hypothetical pr... 30 0.97 Z68117-6|CAA92183.2| 1947|Caenorhabditis elegans Hypothetical pr... 30 0.97 X08066-1|CAA30855.1| 1947|Caenorhabditis elegans myosin heavy ch... 30 0.97 U13070-7|AAC46638.1| 414|Caenorhabditis elegans Rabaptin (rab e... 30 0.97 M37235-1|AAA28122.1| 273|Caenorhabditis elegans myosin II protein. 30 0.97 AF014939-5|AAB63928.2| 302|Caenorhabditis elegans Hypothetical ... 29 3.0 AC084155-5|AAK84606.1| 433|Caenorhabditis elegans Hypothetical ... 29 3.0 U22831-14|AAN84802.1| 334|Caenorhabditis elegans G-protein-link... 28 5.2 U22831-12|AAL65784.1| 614|Caenorhabditis elegans G-protein-link... 28 5.2 U22831-11|AAL65783.1| 627|Caenorhabditis elegans G-protein-link... 28 5.2 U22831-10|AAM98012.1| 667|Caenorhabditis elegans G-protein-link... 28 5.2 AY053365-1|AAL15153.1| 627|Caenorhabditis elegans G-protein-lin... 28 5.2 AY053364-1|AAL15152.1| 664|Caenorhabditis elegans G-protein-lin... 28 5.2 AF272738-1|AAK94896.1| 614|Caenorhabditis elegans G protein-lin... 28 5.2 >U50309-7|AAG24132.1| 1974|Caenorhabditis elegans Hypothetical protein F58G4.1 protein. Length = 1974 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 511 IESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREE 383 +ESTLDEL L+ +R D +Q ++ ++ + I QE+ EE Sbjct: 1037 LESTLDELEDTLEREKRGRQDCEKQRRK-VEGELKIAQELIEE 1078 >Z68119-8|CAA92197.2| 1947|Caenorhabditis elegans Hypothetical protein T18D3.4 protein. Length = 1947 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 511 IESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 377 +E+ ++EL ALD + N+D + ++ L ++Q + EE K Sbjct: 1634 LEADINELEIALDHANKANEDAQKNIRRYLDQIRELQQTVDEEQK 1678 >Z68117-6|CAA92183.2| 1947|Caenorhabditis elegans Hypothetical protein T18D3.4 protein. Length = 1947 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 511 IESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 377 +E+ ++EL ALD + N+D + ++ L ++Q + EE K Sbjct: 1634 LEADINELEIALDHANKANEDAQKNIRRYLDQIRELQQTVDEEQK 1678 >X08066-1|CAA30855.1| 1947|Caenorhabditis elegans myosin heavy chain 2 protein. Length = 1947 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 511 IESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 377 +E+ ++EL ALD + N+D + ++ L ++Q + EE K Sbjct: 1634 LEADINELEIALDHANKANEDAQKNIRRYLDQIRELQQTVDEEQK 1678 >U13070-7|AAC46638.1| 414|Caenorhabditis elegans Rabaptin (rab effector) protein 5 protein. Length = 414 Score = 30.3 bits (65), Expect = 0.97 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = -3 Query: 511 IESTLDELNSALDFLERKNDD---IHQQLKELLQSNIAIRQEMREENKDV 371 IE D+LN A D L++ +DD + ++ K+LL S QE+R E D+ Sbjct: 125 IEVFTDQLNLARDKLQQADDDFVTLGKKYKKLLGSTRKSAQELRSEKIDM 174 >M37235-1|AAA28122.1| 273|Caenorhabditis elegans myosin II protein. Length = 273 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 511 IESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENK 377 +E+ ++EL ALD + N+D + ++ L ++Q + EE K Sbjct: 134 LEADINELEIALDHANKANEDAQKNIRRYLDQIRELQQTVDEEQK 178 >AF014939-5|AAB63928.2| 302|Caenorhabditis elegans Hypothetical protein ZC132.6 protein. Length = 302 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -3 Query: 508 ESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMRE 386 EST++ LN L + KND I Q KEL ++ + I ++R+ Sbjct: 154 ESTINSLNEKLLKEKSKNDSIQAQ-KELYENLVIIIDQLRQ 193 >AC084155-5|AAK84606.1| 433|Caenorhabditis elegans Hypothetical protein Y45G5AM.7 protein. Length = 433 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = -3 Query: 526 RRV*IIESTLDELNSALDFLERKNDDIHQQLKELLQSNIAIRQEMREENKDVSNSN 359 R V I++ L + + LE DD+H+++ L SN + + + + +SNS+ Sbjct: 152 RNVEILQEENSNLTAKNEKLEETVDDLHEKVANLETSNKELTEINVDNERKISNSS 207 >U22831-14|AAN84802.1| 334|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 2, isoform e protein. Length = 334 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 31 YYVLLTHFFFCEQCSTKCYFSFLLT*ICNL*HLNGANKLNNYSY 162 +YVL T + FCE C F+ L T L ++N + LN + Y Sbjct: 271 FYVLATIYGFCETCKASPSFNTLYTISYYLCYMN--SPLNPFCY 312 >U22831-12|AAL65784.1| 614|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 2, isoform b protein. Length = 614 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 31 YYVLLTHFFFCEQCSTKCYFSFLLT*ICNL*HLNGANKLNNYSY 162 +YVL T + FCE C F+ L T L ++N + LN + Y Sbjct: 551 FYVLATIYGFCETCKASPSFNTLYTISYYLCYMN--SPLNPFCY 592 >U22831-11|AAL65783.1| 627|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 2, isoform a protein. Length = 627 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 31 YYVLLTHFFFCEQCSTKCYFSFLLT*ICNL*HLNGANKLNNYSY 162 +YVL T + FCE C F+ L T L ++N + LN + Y Sbjct: 564 FYVLATIYGFCETCKASPSFNTLYTISYYLCYMN--SPLNPFCY 605 >U22831-10|AAM98012.1| 667|Caenorhabditis elegans G-protein-linked acetylcholinereceptor protein 2, isoform c protein. Length = 667 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 31 YYVLLTHFFFCEQCSTKCYFSFLLT*ICNL*HLNGANKLNNYSY 162 +YVL T + FCE C F+ L T L ++N + LN + Y Sbjct: 604 FYVLATIYGFCETCKASPSFNTLYTISYYLCYMN--SPLNPFCY 645 >AY053365-1|AAL15153.1| 627|Caenorhabditis elegans G-protein-linked acetylcholinereceptor GAR-2b protein. Length = 627 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 31 YYVLLTHFFFCEQCSTKCYFSFLLT*ICNL*HLNGANKLNNYSY 162 +YVL T + FCE C F+ L T L ++N + LN + Y Sbjct: 564 FYVLATIYGFCETCKASPSFNTLYTISYYLCYMN--SPLNPFCY 605 >AY053364-1|AAL15152.1| 664|Caenorhabditis elegans G-protein-linked acetylcholinereceptor GAR-2a protein. Length = 664 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 31 YYVLLTHFFFCEQCSTKCYFSFLLT*ICNL*HLNGANKLNNYSY 162 +YVL T + FCE C F+ L T L ++N + LN + Y Sbjct: 601 FYVLATIYGFCETCKASPSFNTLYTISYYLCYMN--SPLNPFCY 642 >AF272738-1|AAK94896.1| 614|Caenorhabditis elegans G protein-linked acetylcholinereceptor GAR-2c protein. Length = 614 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 31 YYVLLTHFFFCEQCSTKCYFSFLLT*ICNL*HLNGANKLNNYSY 162 +YVL T + FCE C F+ L T L ++N + LN + Y Sbjct: 551 FYVLATIYGFCETCKASPSFNTLYTISYYLCYMN--SPLNPFCY 592 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,967,190 Number of Sequences: 27780 Number of extensions: 213097 Number of successful extensions: 638 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1134321766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -