BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30035X (555 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 25 0.68 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 25 0.68 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 25 0.68 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 24 1.2 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 6.3 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 24.6 bits (51), Expect = 0.68 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 344 ICISSITVADVLIFFTHFLSNCNIGL 421 + I S+TV ++ +F HF S N G+ Sbjct: 448 VSIESVTVDKLITYFDHFESMLNNGV 473 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 24.6 bits (51), Expect = 0.68 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 344 ICISSITVADVLIFFTHFLSNCNIGL 421 + I S+TV ++ +F HF S N G+ Sbjct: 448 VSIESVTVDKLITYFDHFESMLNNGV 473 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 24.6 bits (51), Expect = 0.68 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 344 ICISSITVADVLIFFTHFLSNCNIGL 421 + I S+TV ++ +F HF S N G+ Sbjct: 74 VSIESVTVDKLITYFDHFESMLNNGV 99 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.8 bits (49), Expect = 1.2 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = -1 Query: 453 MIFTNN*KSFCNPILQLDKKCV-----KKIRTSATVIEEMQIQHYFKFNCANIH 307 MIFTNN +F N +L K V I S T + + + +Y N I+ Sbjct: 1 MIFTNNIAAFQNVVLVKKVKIVLLIFYGSIMFSMTQVNKEECDYYQNLNLGEIY 54 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 6.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 511 IESTLDELNSALDFLERKNDDIHQQL 434 I +DELN + LER D I++ + Sbjct: 296 INRQVDELNFDIQDLERWRDRIYEAI 321 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,866 Number of Sequences: 438 Number of extensions: 2625 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -