BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30032 (742 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F2E961 Cluster: PREDICTED: similar to alpha-NAC,... 61 3e-08 UniRef50_Q13765 Cluster: Nascent polypeptide-associated complex ... 61 3e-08 UniRef50_UPI0000E2148E Cluster: PREDICTED: similar to KIAA0363; ... 58 3e-07 UniRef50_Q5SWP3 Cluster: NAC-alpha domain-containing protein 1; ... 58 3e-07 UniRef50_O15069 Cluster: NAC-alpha domain-containing protein 1; ... 58 3e-07 UniRef50_UPI0000D9A813 Cluster: PREDICTED: similar to nascent po... 56 7e-07 UniRef50_O97212 Cluster: Possible nascent polypeptide associated... 56 9e-07 UniRef50_UPI00005A170F Cluster: PREDICTED: similar to nascent po... 56 1e-06 UniRef50_UPI0000E7FCB7 Cluster: PREDICTED: similar to mKIAA0363 ... 54 3e-06 UniRef50_P87147 Cluster: Nascent polypeptide-associated complex ... 54 5e-06 UniRef50_Q94518 Cluster: Nascent polypeptide-associated complex ... 54 5e-06 UniRef50_A2DAU3 Cluster: NAC domain containing protein; n=3; Tri... 47 6e-04 UniRef50_Q94JX9 Cluster: Nascent polypeptide-associated complex ... 46 7e-04 UniRef50_P0C2C7 Cluster: Nascent polypeptide-associated complex ... 46 0.001 UniRef50_Q8LGC6 Cluster: Nascent polypeptide-associated complex ... 46 0.001 UniRef50_Q756T5 Cluster: Nascent polypeptide-associated complex ... 46 0.001 UniRef50_A6SB28 Cluster: Nascent polypeptide-associated complex ... 45 0.002 UniRef50_Q6CDH0 Cluster: Nascent polypeptide-associated complex ... 44 0.003 UniRef50_Q9LHG9 Cluster: Nascent polypeptide-associated complex ... 41 0.028 UniRef50_Q5CRB7 Cluster: Nascent polypeptide associated complex ... 39 0.11 UniRef50_A7KN23 Cluster: Nascent polypeptide-associated complex ... 39 0.11 UniRef50_Q9VPV7 Cluster: CG4415-PA; n=3; Sophophora|Rep: CG4415-... 38 0.26 UniRef50_P38879 Cluster: Nascent polypeptide-associated complex ... 37 0.45 UniRef50_Q4P341 Cluster: Nascent polypeptide-associated complex ... 37 0.60 UniRef50_Q5DBN5 Cluster: SJCHGC09320 protein; n=1; Schistosoma j... 34 3.2 UniRef50_Q7RBD3 Cluster: Putative uncharacterized protein PY0621... 34 4.2 UniRef50_Q4N187 Cluster: Nascent polypeptide associated complex ... 33 5.6 UniRef50_Q54Q17 Cluster: Putative uncharacterized protein; n=1; ... 33 9.7 >UniRef50_UPI0000F2E961 Cluster: PREDICTED: similar to alpha-NAC, muscle-specific form gp220; n=1; Monodelphis domestica|Rep: PREDICTED: similar to alpha-NAC, muscle-specific form gp220 - Monodelphis domestica Length = 1027 Score = 60.9 bits (141), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VMSQANVSRAKAVRALKNN +DIVNAIMELTM Sbjct: 996 VMSQANVSRAKAVRALKNNSNDIVNAIMELTM 1027 >UniRef50_Q13765 Cluster: Nascent polypeptide-associated complex subunit alpha; n=41; Eukaryota|Rep: Nascent polypeptide-associated complex subunit alpha - Homo sapiens (Human) Length = 215 Score = 60.9 bits (141), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VMSQANVSRAKAVRALKNN +DIVNAIMELTM Sbjct: 184 VMSQANVSRAKAVRALKNNSNDIVNAIMELTM 215 >UniRef50_UPI0000E2148E Cluster: PREDICTED: similar to KIAA0363; n=1; Pan troglodytes|Rep: PREDICTED: similar to KIAA0363 - Pan troglodytes Length = 1226 Score = 57.6 bits (133), Expect = 3e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM+QANVSRAKAVRAL++N SDIVNAIMELTM Sbjct: 1195 VMAQANVSRAKAVRALRDNHSDIVNAIMELTM 1226 >UniRef50_Q5SWP3 Cluster: NAC-alpha domain-containing protein 1; n=3; Murinae|Rep: NAC-alpha domain-containing protein 1 - Mus musculus (Mouse) Length = 1504 Score = 57.6 bits (133), Expect = 3e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM+QANV+RAKAVRALK+N SDIVNAIMELTM Sbjct: 1473 VMAQANVTRAKAVRALKDNHSDIVNAIMELTM 1504 >UniRef50_O15069 Cluster: NAC-alpha domain-containing protein 1; n=4; Homo sapiens|Rep: NAC-alpha domain-containing protein 1 - Homo sapiens (Human) Length = 1562 Score = 57.6 bits (133), Expect = 3e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM+QANVSRAKAVRAL++N SDIVNAIMELTM Sbjct: 1531 VMAQANVSRAKAVRALRDNHSDIVNAIMELTM 1562 >UniRef50_UPI0000D9A813 Cluster: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide; n=1; Macaca mulatta|Rep: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide - Macaca mulatta Length = 408 Score = 56.4 bits (130), Expect = 7e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VMSQANV RAKAV+ALKNN +DIVNAIMELTM Sbjct: 377 VMSQANVWRAKAVQALKNNSNDIVNAIMELTM 408 >UniRef50_O97212 Cluster: Possible nascent polypeptide associated complex subunit, copy 2; n=9; Trypanosomatidae|Rep: Possible nascent polypeptide associated complex subunit, copy 2 - Leishmania major Length = 244 Score = 56.0 bits (129), Expect = 9e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VMSQANVSR+KA++ALKNN DIVN IMELTM Sbjct: 213 VMSQANVSRSKAIKALKNNNGDIVNTIMELTM 244 >UniRef50_UPI00005A170F Cluster: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide; n=1; Canis lupus familiaris|Rep: PREDICTED: similar to nascent polypeptide-associated complex alpha polypeptide - Canis familiaris Length = 167 Score = 55.6 bits (128), Expect = 1e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VMSQANVSRAKAVRALKN ++DI++AIMELTM Sbjct: 136 VMSQANVSRAKAVRALKNKRNDILSAIMELTM 167 >UniRef50_UPI0000E7FCB7 Cluster: PREDICTED: similar to mKIAA0363 protein; n=3; Gallus gallus|Rep: PREDICTED: similar to mKIAA0363 protein - Gallus gallus Length = 1396 Score = 54.4 bits (125), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM+QANVSR KAVRAL++N +DIVNAIMELTM Sbjct: 1365 VMAQANVSRPKAVRALRHNNNDIVNAIMELTM 1396 >UniRef50_P87147 Cluster: Nascent polypeptide-associated complex subunit alpha; n=16; Ascomycota|Rep: Nascent polypeptide-associated complex subunit alpha - Schizosaccharomyces pombe (Fission yeast) Length = 173 Score = 53.6 bits (123), Expect = 5e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM+QANVSRAKAV ALK N SD+VNAIM LTM Sbjct: 142 VMAQANVSRAKAVTALKENNSDVVNAIMSLTM 173 >UniRef50_Q94518 Cluster: Nascent polypeptide-associated complex subunit alpha; n=32; Eukaryota|Rep: Nascent polypeptide-associated complex subunit alpha - Drosophila melanogaster (Fruit fly) Length = 217 Score = 53.6 bits (123), Expect = 5e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 V++QAN +RAKA++ALKNN +DIVNAIMELTM Sbjct: 185 VITQANTTRAKAIKALKNNNNDIVNAIMELTM 216 >UniRef50_A2DAU3 Cluster: NAC domain containing protein; n=3; Trichomonas vaginalis G3|Rep: NAC domain containing protein - Trichomonas vaginalis G3 Length = 167 Score = 46.8 bits (106), Expect = 6e-04 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM QANVSRAKA++AL++N +D+V A+M LT+ Sbjct: 136 VMQQANVSRAKAIKALRDNNNDMVTAVMNLTV 167 >UniRef50_Q94JX9 Cluster: Nascent polypeptide-associated complex subunit alpha-like protein 2; n=15; Magnoliophyta|Rep: Nascent polypeptide-associated complex subunit alpha-like protein 2 - Arabidopsis thaliana (Mouse-ear cress) Length = 217 Score = 46.4 bits (105), Expect = 7e-04 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 VM+QA VSR+KAV+ALK++ DIV+AIMELT Sbjct: 186 VMTQAGVSRSKAVKALKSHDGDIVSAIMELT 216 >UniRef50_P0C2C7 Cluster: Nascent polypeptide-associated complex subunit alpha; n=17; Ascomycota|Rep: Nascent polypeptide-associated complex subunit alpha - Aspergillus terreus (strain NIH 2624) Length = 202 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM+QANVSR KAV+AL+ N +DIVN+IM L++ Sbjct: 171 VMAQANVSRKKAVKALRENDNDIVNSIMALSI 202 >UniRef50_Q8LGC6 Cluster: Nascent polypeptide-associated complex subunit alpha-like protein 5; n=6; Magnoliophyta|Rep: Nascent polypeptide-associated complex subunit alpha-like protein 5 - Arabidopsis thaliana (Mouse-ear cress) Length = 209 Score = 46.0 bits (104), Expect = 0.001 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 VM+QA VS+AKAV ALK N DIV+AIMELT Sbjct: 178 VMTQAGVSKAKAVSALKANDGDIVSAIMELT 208 >UniRef50_Q756T5 Cluster: Nascent polypeptide-associated complex subunit alpha; n=1; Eremothecium gossypii|Rep: Nascent polypeptide-associated complex subunit alpha - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 168 Score = 45.6 bits (103), Expect = 0.001 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 VM QANVSR KAV+AL+ + SDIVNAIM L+ Sbjct: 137 VMQQANVSRNKAVKALREHNSDIVNAIMSLS 167 >UniRef50_A6SB28 Cluster: Nascent polypeptide-associated complex alpha polypeptide; n=2; Sclerotiniaceae|Rep: Nascent polypeptide-associated complex alpha polypeptide - Botryotinia fuckeliana B05.10 Length = 212 Score = 44.8 bits (101), Expect = 0.002 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 VM+QA+VSR KAV+ALK N +DIVN+IM L++ Sbjct: 181 VMTQASVSRNKAVKALKENDNDIVNSIMALSI 212 >UniRef50_Q6CDH0 Cluster: Nascent polypeptide-associated complex subunit alpha; n=1; Yarrowia lipolytica|Rep: Nascent polypeptide-associated complex subunit alpha - Yarrowia lipolytica (Candida lipolytica) Length = 198 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMEL 90 VM QANVSR KA+ LK N SD+VN IM+L Sbjct: 167 VMEQANVSRNKAINGLKKNDSDVVNTIMDL 196 >UniRef50_Q9LHG9 Cluster: Nascent polypeptide-associated complex subunit alpha-like protein 1; n=2; Eukaryota|Rep: Nascent polypeptide-associated complex subunit alpha-like protein 1 - Arabidopsis thaliana (Mouse-ear cress) Length = 203 Score = 41.1 bits (92), Expect = 0.028 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 VM+QA VSR AV+ALK DIV+AIMELT Sbjct: 172 VMTQAGVSRPNAVKALKAADGDIVSAIMELT 202 >UniRef50_Q5CRB7 Cluster: Nascent polypeptide associated complex alpha chain with an NAC domain; n=2; Cryptosporidium|Rep: Nascent polypeptide associated complex alpha chain with an NAC domain - Cryptosporidium parvum Iowa II Length = 196 Score = 39.1 bits (87), Expect = 0.11 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 V++Q SRAKAV+ALK+N +D+V AI+ L+ Sbjct: 165 VINQTGCSRAKAVKALKSNNNDVVEAILSLS 195 >UniRef50_A7KN23 Cluster: Nascent polypeptide-associated complex subunit alpha; n=8; Melampsora medusae f. sp. deltoidis|Rep: Nascent polypeptide-associated complex subunit alpha - Melampsora medusae f. sp. deltoidis Length = 181 Score = 39.1 bits (87), Expect = 0.11 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIM 84 VM+Q N SR KAV+ALK N D++NAI+ Sbjct: 151 VMTQVNCSRNKAVKALKENDGDLINAII 178 >UniRef50_Q9VPV7 Cluster: CG4415-PA; n=3; Sophophora|Rep: CG4415-PA - Drosophila melanogaster (Fruit fly) Length = 347 Score = 37.9 bits (84), Expect = 0.26 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELTM 96 V QA SR KA++AL N +D+VNAIM LT+ Sbjct: 315 VQMQAACSRKKAIQALLKNDNDVVNAIMALTV 346 >UniRef50_P38879 Cluster: Nascent polypeptide-associated complex subunit alpha; n=11; Saccharomycetales|Rep: Nascent polypeptide-associated complex subunit alpha - Saccharomyces cerevisiae (Baker's yeast) Length = 174 Score = 37.1 bits (82), Expect = 0.45 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 V+ Q NVS+ +A++ALK + D+VNAIM L+ Sbjct: 143 VVQQTNVSKNQAIKALKAHNGDLVNAIMSLS 173 >UniRef50_Q4P341 Cluster: Nascent polypeptide-associated complex subunit alpha; n=1; Ustilago maydis|Rep: Nascent polypeptide-associated complex subunit alpha - Ustilago maydis (Smut fungus) Length = 190 Score = 36.7 bits (81), Expect = 0.60 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIM 84 VM Q + SR KAV+ALK + D++NAIM Sbjct: 160 VMQQVSCSRRKAVKALKESNGDLINAIM 187 >UniRef50_Q5DBN5 Cluster: SJCHGC09320 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09320 protein - Schistosoma japonicum (Blood fluke) Length = 226 Score = 34.3 bits (75), Expect = 3.2 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIV 72 +M QA VSR+KA+RAL+ N D+V Sbjct: 181 IMQQAGVSRSKAIRALRENNDDMV 204 >UniRef50_Q7RBD3 Cluster: Putative uncharacterized protein PY06211; n=1; Plasmodium yoelii yoelii|Rep: Putative uncharacterized protein PY06211 - Plasmodium yoelii yoelii Length = 52 Score = 33.9 bits (74), Expect = 4.2 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 ++SQ ++ KA+ LK N +D+V +IMEL+ Sbjct: 21 IISQTKCTKEKAIEVLKKNNNDLVQSIMELS 51 >UniRef50_Q4N187 Cluster: Nascent polypeptide associated complex alpha subunit, putative; n=2; Theileria|Rep: Nascent polypeptide associated complex alpha subunit, putative - Theileria parva Length = 200 Score = 33.5 bits (73), Expect = 5.6 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = +1 Query: 1 VMSQANVSRAKAVRALKNNQSDIVNAIMELT 93 V+ QA SR KAV++L ++ +IV +IMELT Sbjct: 168 VVQQAGCSREKAVQSLVKHRGNIVESIMELT 198 >UniRef50_Q54Q17 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 631 Score = 32.7 bits (71), Expect = 9.7 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 1/98 (1%) Frame = -2 Query: 726 QNCTISIAS-FLYMILSFQLLYAVRQFIAYKEAKNRPFTYKNHHINH*GSVSSC*YVALS 550 +N +I I S FL++++ L+ + I K+ +N + K H N+ ++ C V+ Sbjct: 13 KNSSIIINSNFLFILIIEPLIDYL--LIKKKKRENNKYNIKRFHFNNEELITFC-LVSKK 69 Query: 549 QFHRFKKKVHFSTIFRFRFVNLKYNKTSFLNDSQIFSV 436 F+ + + S F+F ++N N +F N +QIF + Sbjct: 70 WFNLISEII--SNAFKFNYIN--NNSINFRNKNQIFKI 103 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,782,991 Number of Sequences: 1657284 Number of extensions: 11652998 Number of successful extensions: 25390 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 24542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25385 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60500186565 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -