BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30031 (383 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 24 2.2 EF426178-1|ABO26421.1| 155|Anopheles gambiae unknown protein. 23 3.8 EF426177-1|ABO26420.1| 155|Anopheles gambiae unknown protein. 23 3.8 EF426173-1|ABO26416.1| 155|Anopheles gambiae unknown protein. 23 3.8 EF426172-1|ABO26415.1| 155|Anopheles gambiae unknown protein. 23 3.8 EF426171-1|ABO26414.1| 155|Anopheles gambiae unknown protein. 23 3.8 EF426170-1|ABO26413.1| 155|Anopheles gambiae unknown protein. 23 3.8 EF426163-1|ABO26406.1| 155|Anopheles gambiae unknown protein. 23 3.8 EF426161-1|ABO26404.1| 155|Anopheles gambiae unknown protein. 23 3.8 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 3.8 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 3.8 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 23 5.1 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 22 6.7 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 22 6.7 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 22 6.7 DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 22 8.9 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 22 8.9 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 22 8.9 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.8 bits (49), Expect = 2.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 92 TQYKKSKERHAAQGRRRYDRKQQGYG 169 T Y + E + +GRRR + QQ YG Sbjct: 12 TDYDLANEFNPNRGRRRPTKNQQIYG 37 >EF426178-1|ABO26421.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >EF426177-1|ABO26420.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >EF426173-1|ABO26416.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >EF426172-1|ABO26415.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >EF426171-1|ABO26414.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >EF426170-1|ABO26413.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >EF426163-1|ABO26406.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >EF426161-1|ABO26404.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.0 bits (47), Expect = 3.8 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 382 FFFFFFRQWSYLLEAFKIGSSVPFSSCHHQAQSA-CISSMQ 263 FF F Q L ++ S +S C AQS C S+ Q Sbjct: 15 FFGALFAQSVSALRCYQCASPSSWSDCQASAQSVECTSASQ 55 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 352 YLLEAFKIGSSVPFSSCHHQAQSACISS 269 YL+ +F G +P+S C+ + CI S Sbjct: 181 YLIASF--GDPLPWSECNDAWNATCIDS 206 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 352 YLLEAFKIGSSVPFSSCHHQAQSACISS 269 YL+ +F G +P+S C+ + CI S Sbjct: 181 YLIASF--GDPLPWSECNDAWNATCIDS 206 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 22.6 bits (46), Expect = 5.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 121 VPFLGLFVLCYLVYFVAFTFFAVRPALFWYVH 26 VP + LF+L L F A+ P WYV+ Sbjct: 3 VPRVLLFILLELFVQATQAFKALDPEEAWYVY 34 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 25 LFIFCSI-----FTFSFYTPALDYYLNH 47 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 25 LFIFCSI-----FTFSFYTPALDYYLNH 47 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 106 LFVLCYLVYFVAFTFFAVRPALFWYVHH 23 LF+ C + FTF PAL +Y++H Sbjct: 36 LFIFCSI-----FTFSFYTPALDYYLNH 58 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 323 ICPFLFLSPPSSKCLHLFNATC 258 +C F+ P +KC H F C Sbjct: 249 VCRESFVDPIVTKCKHYFCERC 270 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 323 ICPFLFLSPPSSKCLHLFNATC 258 +C F+ P +KC H F C Sbjct: 249 VCRESFVDPIVTKCKHYFCERC 270 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 121 VPFLGLFVLCYLVYFVAFTF 62 VP F+ +L++FV F+F Sbjct: 49 VPLFINFIFMFLLHFVLFSF 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 399,761 Number of Sequences: 2352 Number of extensions: 8042 Number of successful extensions: 67 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -