BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30030 (675 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U57846-1|AAB02265.1| 51|Homo sapiens ribosomal protein L39 pro... 81 3e-15 D79205-1|BAA11465.1| 51|Homo sapiens ribosomal protein L39 pro... 81 3e-15 BC070205-1|AAH70205.1| 51|Homo sapiens ribosomal protein L39 p... 81 3e-15 BC001019-1|AAH01019.1| 51|Homo sapiens ribosomal protein L39 p... 81 3e-15 AB061835-1|BAB79473.1| 51|Homo sapiens ribosomal protein L39 p... 81 3e-15 AB209077-1|BAD92314.1| 70|Homo sapiens ribosomal protein L39 v... 79 2e-14 L05096-1|AAC15859.1| 51|Homo sapiens ribosomal protein L39 pro... 75 2e-13 BC012328-1|AAH12328.1| 51|Homo sapiens ribosomal protein L39-l... 75 2e-13 AF548529-1|AAN52397.1| 51|Homo sapiens ribosomal protein L39-2... 75 2e-13 AB063610-1|BAC19837.1| 51|Homo sapiens ribosomal protein L39-l... 75 2e-13 AB063607-1|BAC19834.1| 29|Homo sapiens ribosomal protein L39-l... 39 0.014 AB065849-1|BAC06067.1| 314|Homo sapiens seven transmembrane hel... 31 3.7 >U57846-1|AAB02265.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 81.4 bits (192), Expect = 3e-15 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >D79205-1|BAA11465.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 81.4 bits (192), Expect = 3e-15 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >BC070205-1|AAH70205.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 81.4 bits (192), Expect = 3e-15 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >BC001019-1|AAH01019.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 81.4 bits (192), Expect = 3e-15 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >AB061835-1|BAB79473.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 81.4 bits (192), Expect = 3e-15 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW+RM+TGN IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL 51 >AB209077-1|BAD92314.1| 70|Homo sapiens ribosomal protein L39 variant protein. Length = 70 Score = 78.6 bits (185), Expect = 2e-14 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 K+ LAKK KQNRPIPQW+RM+TGN IRYN+KRRHW+RTKL L Sbjct: 29 KQFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWKRTKLGL 70 >L05096-1|AAC15859.1| 51|Homo sapiens ribosomal protein L39 protein. Length = 51 Score = 75.4 bits (177), Expect = 2e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 >BC012328-1|AAH12328.1| 51|Homo sapiens ribosomal protein L39-like protein. Length = 51 Score = 75.4 bits (177), Expect = 2e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 >AF548529-1|AAN52397.1| 51|Homo sapiens ribosomal protein L39-2 protein. Length = 51 Score = 75.4 bits (177), Expect = 2e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 >AB063610-1|BAC19837.1| 51|Homo sapiens ribosomal protein L39-like protein. Length = 51 Score = 75.4 bits (177), Expect = 2e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 72 KR LAKK KQNRPIPQW++M+ G+ IRYN+KRRHWRRTKL L Sbjct: 10 KRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL 51 >AB063607-1|BAC19834.1| 29|Homo sapiens ribosomal protein L39-like protein. Length = 29 Score = 39.1 bits (87), Expect = 0.014 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 197 KRKLAKKLKQNRPIPQWVRM 138 KR LAKK KQNRPIPQW++M Sbjct: 10 KRFLAKKQKQNRPIPQWIQM 29 >AB065849-1|BAC06067.1| 314|Homo sapiens seven transmembrane helix receptor protein. Length = 314 Score = 31.1 bits (67), Expect = 3.7 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +1 Query: 502 VISYIFFLLIFTFRHVFSGFNFKLLTCIKHV*KSLSY*LTIVLV 633 +ISY+F L+ RH G+ L TC H+ + +T++++ Sbjct: 213 LISYLFILITILKRHTGKGYQKPLSTCGSHLIAIFLFYITVIIM 256 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,039,070 Number of Sequences: 237096 Number of extensions: 1398803 Number of successful extensions: 5803 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 5750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5803 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7615267504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -