BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30026X (380 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 24 0.52 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 23 0.92 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 6.5 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 6.5 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 6.5 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 6.5 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 6.5 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 6.5 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 6.5 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 6.5 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 6.5 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 6.5 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 6.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 6.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 6.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 6.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 6.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 6.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 6.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 6.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 6.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 6.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 20 8.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 20 8.5 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 24.2 bits (50), Expect = 0.52 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -3 Query: 198 RFHLLKECDSISLVDILF-HDMSNDLNQ**GIYFAFEGGQKVIVQLYEVVSPLQGR 34 RF L+ +C ++ F + ND + GIYF E QK+ + P + R Sbjct: 63 RFKLVTDCIFVTSEPGYFLYTSKNDNEEVCGIYFLAEPDQKIEINFITFDIPCEHR 118 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 23.4 bits (48), Expect = 0.92 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = -1 Query: 104 ILLSKVVKKLLYNCMRLSPL 45 ++ +++ KLL NC+R+SP+ Sbjct: 19 VIPAELTAKLLGNCVRVSPV 38 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 4 CSRDRNREYRKKDRR 18 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 237 CSRDRNREYRKKDRR 251 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 237 CSRDRNREYRKKDRR 251 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 237 CSRDRNREYRKKDRR 251 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 237 CSRDRNREYRKKDRR 251 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 237 CSRDRNREYRKKDRR 251 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 226 CSRDRNREYRKKDRR 240 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 237 CSRDRNREYRKKDRR 251 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 242 CSRDRNREYRKKDRR 256 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 20.6 bits (41), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 281 CSRENN*TFRKYTRR 325 CSR+ N +RK RR Sbjct: 237 CSRDRNREYRKKDRR 251 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 20.2 bits (40), Expect = 8.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 122 TNDRGFILLSKVVKKLLY 69 T D+ F+L K V LLY Sbjct: 28 TADKDFLLKQKKVYNLLY 45 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 20.2 bits (40), Expect = 8.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 122 TNDRGFILLSKVVKKLLY 69 T D+ F+L K V LLY Sbjct: 28 TADKDFLLKQKKVYNLLY 45 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,868 Number of Sequences: 438 Number of extensions: 2416 Number of successful extensions: 24 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -