BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30024 (758 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024202-12|AAF36031.2| 143|Caenorhabditis elegans Hypothetical... 32 0.51 AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical... 29 4.7 Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical pr... 28 8.3 Z77659-8|CAB01170.1| 958|Caenorhabditis elegans Hypothetical pr... 28 8.3 Z77657-11|CAB01153.1| 958|Caenorhabditis elegans Hypothetical p... 28 8.3 AF295093-1|AAG03081.1| 958|Caenorhabditis elegans bimC kinesin ... 28 8.3 AB024428-1|BAC19818.1| 958|Caenorhabditis elegans kinesin like ... 28 8.3 >AC024202-12|AAF36031.2| 143|Caenorhabditis elegans Hypothetical protein Y71H2B.1 protein. Length = 143 Score = 31.9 bits (69), Expect = 0.51 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 111 LYMSVVIGEYETAIA-KCSEYLKEKKGEVIKEAVKRLIE 224 LYM +G+Y+ A KC +Y K+ G+ EA++ I+ Sbjct: 87 LYMQATVGDYDGNTALKCGQYWKKHSGKTQIEAIREYIK 125 >AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical protein D1007.7 protein. Length = 988 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 176 GKEGRGYQGSREASDRKRQEEHHGLRHQLWTKDGK 280 G+E R Y R DR+RQ++ R W D + Sbjct: 846 GREHRDYDRDRSQIDRRRQDDMGARRRSRWGDDDR 880 >Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical protein F33E2.6 protein. Length = 846 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 420 PKTKPARKSPGSLPPCWKTTE--FTSRSCPPR 509 PKT+P P ++P CW+ F PPR Sbjct: 418 PKTEPPTTEPPNIPYCWQQQSRLFAPSPPPPR 449 >Z77659-8|CAB01170.1| 958|Caenorhabditis elegans Hypothetical protein F23B12.8 protein. Length = 958 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 466 VGKQQSLLQDHVHRDKQYLKLDNTKGSSDDRI 561 V + + +D +H D+QY +L KG +DR+ Sbjct: 412 VDRLRIFTEDQMHMDEQYRQLYERKGELEDRL 443 >Z77657-11|CAB01153.1| 958|Caenorhabditis elegans Hypothetical protein F23B12.8 protein. Length = 958 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 466 VGKQQSLLQDHVHRDKQYLKLDNTKGSSDDRI 561 V + + +D +H D+QY +L KG +DR+ Sbjct: 412 VDRLRIFTEDQMHMDEQYRQLYERKGELEDRL 443 >AF295093-1|AAG03081.1| 958|Caenorhabditis elegans bimC kinesin BMK-1 protein. Length = 958 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 466 VGKQQSLLQDHVHRDKQYLKLDNTKGSSDDRI 561 V + + +D +H D+QY +L KG +DR+ Sbjct: 412 VDRLRIFTEDQMHMDEQYRQLYERKGELEDRL 443 >AB024428-1|BAC19818.1| 958|Caenorhabditis elegans kinesin like protein KLP-14 protein. Length = 958 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 466 VGKQQSLLQDHVHRDKQYLKLDNTKGSSDDRI 561 V + + +D +H D+QY +L KG +DR+ Sbjct: 412 VDRLRIFTEDQMHMDEQYRQLYERKGELEDRL 443 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,561,030 Number of Sequences: 27780 Number of extensions: 377519 Number of successful extensions: 1465 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1464 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -