BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30021 (374 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.15 |rps2501|rps25-1|40S ribosomal protein S25|Schizosacc... 45 3e-06 SPAC694.05c |rps2502|rps25-2, rps25|40S ribosomal protein S25|Sc... 45 3e-06 SPAC1A6.04c |plb1||phospholipase B homolog Plb1|Schizosaccharomy... 30 0.10 SPAPB1E7.08c |||membrane transporter|Schizosaccharomyces pombe|c... 29 0.31 SPAC821.05 |||translation initiation factor eIF3h|Schizosaccharo... 29 0.31 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 27 0.73 SPAC30D11.08c |phf2|swp2, saf60|PHD finger containing protein Ph... 27 0.96 SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyc... 25 3.9 SPBC28F2.07 |sfr1|dds20, mug13|Swi five-dependent recombination ... 25 5.1 SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosa... 25 5.1 SPCC1450.15 |||pig-F |Schizosaccharomyces pombe|chr 3|||Manual 24 6.8 SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 24 6.8 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 24 6.8 SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosacchar... 24 6.8 SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomy... 24 9.0 >SPBC3D6.15 |rps2501|rps25-1|40S ribosomal protein S25|Schizosaccharomyces pombe|chr 2|||Manual Length = 88 Score = 45.2 bits (102), Expect = 3e-06 Identities = 19/46 (41%), Positives = 34/46 (73%) Frame = +1 Query: 124 LFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELRKK 261 +FDK +++ KEVP +K I+ +V+ +R+K+ GSLAR A+ +L ++ Sbjct: 21 VFDKSIIDRINKEVPAFKFISVSVLVDRMKINGSLARIAIRDLAER 66 Score = 28.7 bits (61), Expect = 0.31 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 255 EKGLIKQVVQHHGQVIYTRA 314 E+G+I++V QH Q IYTRA Sbjct: 65 ERGVIQKVDQHSKQAIYTRA 84 >SPAC694.05c |rps2502|rps25-2, rps25|40S ribosomal protein S25|Schizosaccharomyces pombe|chr 1|||Manual Length = 89 Score = 45.2 bits (102), Expect = 3e-06 Identities = 19/46 (41%), Positives = 34/46 (73%) Frame = +1 Query: 124 LFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELRKK 261 +FDK +++ KEVP +K I+ +V+ +R+K+ GSLAR A+ +L ++ Sbjct: 21 VFDKSIIDRINKEVPAFKFISVSVLVDRMKINGSLARIAIRDLAER 66 Score = 27.1 bits (57), Expect = 0.96 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 255 EKGLIKQVVQHHGQVIYTR 311 E+G+I++V QH Q IYTR Sbjct: 65 ERGVIQKVDQHSKQAIYTR 83 >SPAC1A6.04c |plb1||phospholipase B homolog Plb1|Schizosaccharomyces pombe|chr 1|||Manual Length = 613 Score = 30.3 bits (65), Expect = 0.10 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = -1 Query: 275 LFDETFFLSSMSALLAREPRTFN--LSDTTAGVISLYCGTSLYSFSYVGLSNNT---WLF 111 +F+ F+ S M+ + + FN LSD VIS G + Y F V LS+ T W Sbjct: 198 VFNAHFYSSIMNEVAEKANAGFNISLSDYWGRVISRTLGDTTYGFPNVSLSSITSQEWYR 257 Query: 110 NLSRTFPLDHF 78 N + +P+ F Sbjct: 258 NANFPYPIITF 268 >SPAPB1E7.08c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 554 Score = 28.7 bits (61), Expect = 0.31 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = -1 Query: 248 SMSALLAREPRTFNLSDTTAGVISLYCGTSLYSFSYVGLSNNTWLFNLSRTFPLDHFFFL 69 S+SA FNL+ GV ++ G S +F+ + + + W F + P+D FL Sbjct: 139 SLSADTIGRRWAFNLTFLFTGVFAVIAGASP-NFASICVFDALWSFGVGGNLPVDSAIFL 197 Query: 68 -ALP 60 ALP Sbjct: 198 EALP 201 >SPAC821.05 |||translation initiation factor eIF3h|Schizosaccharomyces pombe|chr 1|||Manual Length = 357 Score = 28.7 bits (61), Expect = 0.31 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -2 Query: 145 HMWVYQTTPGCSTCHELFLWTTSSSWLCRHRILPSSSV 32 +M YQ TP HE WT SS L H + PS+ + Sbjct: 152 YMRAYQLTPEFMAAHEEKTWTASS--LNSHNLTPSNVI 187 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 27.5 bits (58), Expect = 0.73 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 152 SFSYVGLSNNTWLFNLSRTFPLDHFFFLALPPP 54 SF Y L NN++L +S + ++ F++ PPP Sbjct: 1008 SFIYGSLQNNSFLSRVSPSSLEENVFYIQHPPP 1040 >SPAC30D11.08c |phf2|swp2, saf60|PHD finger containing protein Phf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 538 Score = 27.1 bits (57), Expect = 0.96 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 26 KKHRRRRKDPVAAKPRRRSGPKEKFVTS*TTRC 124 K HR DP+ P RR GP + V + +C Sbjct: 203 KVHRPNHFDPLVKLPTRRRGPGRRPVVALAMKC 235 >SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 150 Score = 25.0 bits (52), Expect = 3.9 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 185 VISLYCGTSLYSFSYV-GLSNNTWLFNLSRTFPLDHFFFLALPPP 54 V+ + C +L F ++ G+ N T P +F+ L PPP Sbjct: 37 VVVIICIAALIFFFFIIGIINRRRTKKGQATIPFTNFYPLTAPPP 81 >SPBC28F2.07 |sfr1|dds20, mug13|Swi five-dependent recombination repair protein Sfr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 299 Score = 24.6 bits (51), Expect = 5.1 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +2 Query: 5 RLRPNSLKKHRRRRKDPVAAKPRRRSGPKEKFVTS*TTRCCLINPHMRN 151 R PNS+K+ +R K P++ +S P+ +T +R + +RN Sbjct: 150 RTTPNSIKRQKRLFKSPISNCLNPKSDPE---ITQLLSRRLKLEKEVRN 195 >SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 24.6 bits (51), Expect = 5.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 346 IVYATGSSPLVARV*ITCP*CWTTCLMRP 260 I+Y T ++P++ + +T CW L P Sbjct: 260 ILYKTNNNPIILPITVTVCSCWWLILSTP 288 >SPCC1450.15 |||pig-F |Schizosaccharomyces pombe|chr 3|||Manual Length = 503 Score = 24.2 bits (50), Expect = 6.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 131 SNNTWLFNLSRTFPLDHFFFLAL 63 S N+W+F L TF F+L+L Sbjct: 316 SRNSWIFTLLLTFTQLTIFYLSL 338 >SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 24.2 bits (50), Expect = 6.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 73 SWLCRHRILPSSSVFFEAVW 14 +WL + ++PSSS F + W Sbjct: 131 AWLEKQELVPSSSNFLNSFW 150 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 24.2 bits (50), Expect = 6.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 212 RSEVPWREEHSSSLGKRSHQTGS 280 +S V W EEH+ L KR+ + S Sbjct: 2213 KSVVCWIEEHNDDLSKRTQELKS 2235 >SPCC18.01c |adg3|SPCC74.07c|beta-glucosidase Adg3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1131 Score = 24.2 bits (50), Expect = 6.8 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = -1 Query: 251 SSMSALLAREPRTFNLSDTTAGVISLYCGTSLYSFSYVGLSNNT--WLFNLSRTFP 90 S+ S L+ EP+TF+ S T + IS SL LS++T L + S T P Sbjct: 946 SASSNTLSTEPKTFSSSSTLSESISSINTNSLTVKPESSLSSSTTSGLTSSSSTIP 1001 >SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 23.8 bits (49), Expect = 9.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 139 TYEKLYKEVPQYKLITPAVVS 201 TY+K+Y E P K++ + S Sbjct: 96 TYKKIYNEYPPTKILVQEIAS 116 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,567,139 Number of Sequences: 5004 Number of extensions: 31681 Number of successful extensions: 135 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 120195862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -