BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30021 (374 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34555.1 68417.m04910 40S ribosomal protein S25, putative 70 4e-13 At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribo... 69 1e-12 At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) 69 1e-12 At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) 67 3e-12 At5g64950.1 68418.m08170 mitochondrial transcription termination... 29 0.76 At1g14500.1 68414.m01719 ankyrin repeat family protein contains ... 29 1.3 At2g17250.1 68415.m01992 expressed protein weak similarity to Ri... 28 2.3 At3g60980.1 68416.m06824 pentatricopeptide (PPR) repeat-containi... 27 4.1 At2g23170.1 68415.m02768 auxin-responsive GH3 family protein sim... 27 5.4 At1g24706.1 68414.m03104 expressed protein 27 5.4 At5g54770.1 68418.m06822 thiazole biosynthetic enzyme, chloropla... 26 7.1 At1g48180.1 68414.m05378 expressed protein ; expression supporte... 26 7.1 At5g44000.1 68418.m05384 glutathione S-transferase C-terminal do... 26 9.4 At5g38830.1 68418.m04697 tRNA synthetase class I (C) family prot... 26 9.4 At5g27640.1 68418.m03311 eukaryotic translation initiation facto... 26 9.4 At4g36670.1 68417.m05203 mannitol transporter, putative similar ... 26 9.4 At2g02810.1 68415.m00226 UDP-galactose/UDP-glucose transporter c... 26 9.4 >At4g34555.1 68417.m04910 40S ribosomal protein S25, putative Length = 108 Score = 70.1 bits (164), Expect = 4e-13 Identities = 30/51 (58%), Positives = 42/51 (82%) Frame = +1 Query: 109 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELRKK 261 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLARRA+ EL K Sbjct: 37 VNNMVLFDQATYDKLLSEAPKFKLITPSILSDRLRINGSLARRAIRELMAK 87 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 258 KGLIKQVVQHHGQVIYTRATKG 323 KG I+ V H Q IYTRAT G Sbjct: 87 KGTIRMVSAHSSQQIYTRATHG 108 >At4g39200.1 68417.m05550 40S ribosomal protein S25 (RPS25E) ribosomal protein S25, Lycopersicon esculentum, PIR2:S40089 Length = 108 Score = 68.9 bits (161), Expect = 1e-12 Identities = 29/51 (56%), Positives = 42/51 (82%) Frame = +1 Query: 109 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELRKK 261 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ EL K Sbjct: 37 VNNMVLFDQATYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAK 87 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 258 KGLIKQVVQHHGQVIYTRAT 317 KG+I+ V H Q IYTRAT Sbjct: 87 KGVIRMVAAHSSQQIYTRAT 106 >At2g21580.1 68415.m02567 40S ribosomal protein S25 (RPS25B) Length = 108 Score = 68.5 bits (160), Expect = 1e-12 Identities = 29/51 (56%), Positives = 42/51 (82%) Frame = +1 Query: 109 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELRKK 261 +NN VLFD+ TY+KL E P++KLITP+++S+R+++ GSLARRA+ EL K Sbjct: 37 VNNMVLFDQGTYDKLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAK 87 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 258 KGLIKQVVQHHGQVIYTRAT 317 KGLI+ V H Q IYTRAT Sbjct: 87 KGLIRMVSAHSSQQIYTRAT 106 >At2g16360.1 68415.m01872 40S ribosomal protein S25 (RPS25A) Length = 125 Score = 67.3 bits (157), Expect = 3e-12 Identities = 28/51 (54%), Positives = 42/51 (82%) Frame = +1 Query: 109 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELRKK 261 +NN VLFD+ TY+KL E P++KLITP+++S+RL++ GSLAR+A+ +L K Sbjct: 53 VNNMVLFDQATYDKLMSEAPKFKLITPSILSDRLRINGSLARKAIRDLMVK 103 >At5g64950.1 68418.m08170 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 391 Score = 29.5 bits (63), Expect = 0.76 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -1 Query: 344 SLCDWIIALGRTRVDHLPMMLDYLFDETFFLSSMSALLAREPRTFNLSD 198 S C W++ + LP + YL S +++LL R+PR FNLS+ Sbjct: 166 SRCGWLLLSRDPNLFLLPN-ISYLETCGIVGSQLASLLRRQPRIFNLSE 213 >At1g14500.1 68414.m01719 ankyrin repeat family protein contains Pfam domain, PF00023: Ankyrin repeat Length = 436 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -1 Query: 173 YCGTSLYSFSYVGLSN--NTWLFNLSRTFPLDHFFFLALPPPDPSFFFC 33 +C LY+F + + + TW F + + + + +A+ P+P F C Sbjct: 342 FCCALLYTFCLLPIGSLFTTWFFWIGASLGVSYALAMAIISPNPLLFLC 390 >At2g17250.1 68415.m01992 expressed protein weak similarity to Ribosome biogenesis protein MAK21 (Swiss-Prot:Q12176) [Saccharomyces cerevisiae] Length = 577 Score = 27.9 bits (59), Expect = 2.3 Identities = 13/47 (27%), Positives = 29/47 (61%) Frame = +1 Query: 112 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIEL 252 +++ + +KPT +K E L++PA +S+R+K++ + A + + L Sbjct: 245 SDESISEKPTDKKKKTEKGDSTLLSPATISKRMKLKFTKAWISFLRL 291 >At3g60980.1 68416.m06824 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 412 Score = 27.1 bits (57), Expect = 4.1 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = -1 Query: 353 LYHSLCDWI-IALGRTRVDHLPMMLDYLFDETFFLSSMSALLAREPRTFNLSDTTAGVIS 177 LYH L D G D + +M+D FD +F +M P+ LSD +I+ Sbjct: 289 LYHELLDKNGTGKGCLDSDTIKIMVDECFDMGWFSEAMETYKKARPKNDYLSDKY--IIT 346 Query: 176 LYCGTSLYS 150 +C + S Sbjct: 347 RFCENRMLS 355 >At2g23170.1 68415.m02768 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 595 Score = 26.6 bits (56), Expect = 5.4 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 147 LICGFIKQHLVVQLVTNFSFGPLLLLGFAAT 55 ++CG + +H V++L F+ G L +GF T Sbjct: 213 MLCGLLMRHEVLRLGAVFASGLLRAIGFLQT 243 >At1g24706.1 68414.m03104 expressed protein Length = 1781 Score = 26.6 bits (56), Expect = 5.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 110 NLSRTFPLDHFFFLALPPPDP 48 +L ++ P DHF LPPP P Sbjct: 1562 SLEKSHPDDHFHSQGLPPPPP 1582 >At5g54770.1 68418.m06822 thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) identical to SP|Q38814 Thiazole biosynthetic enzyme, chloroplast precursor (ARA6) {Arabidopsis thaliana} Length = 349 Score = 26.2 bits (55), Expect = 7.1 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 3/33 (9%) Frame = -1 Query: 275 LFDETFFLSSMSAL---LAREPRTFNLSDTTAG 186 LFD +F S++SA + +PR+F++ TTAG Sbjct: 18 LFDSSFHGSAISAAPISIGLKPRSFSVRATTAG 50 >At1g48180.1 68414.m05378 expressed protein ; expression supported by MPSS Length = 239 Score = 26.2 bits (55), Expect = 7.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 206 LSDTTAGVISLYCGTSLYSFSYVGL 132 L + + +YCGTS SYVGL Sbjct: 149 LQQDASAITGIYCGTSGEPASYVGL 173 >At5g44000.1 68418.m05384 glutathione S-transferase C-terminal domain-containing protein contains Pfam domain PF00043: Glutathione S-transferase, C-terminal domain Length = 399 Score = 25.8 bits (54), Expect = 9.4 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -3 Query: 261 LFPKLDECSSRQGTSDL*SFR---YDSRCD*LVLWDFLVQFLIC 139 L P LD+ + + ++ R YD RC +LWD + ++C Sbjct: 161 LIPSLDKANRCRNLKEVYKSRSGGYDGRCTVPMLWDLRKKDVVC 204 >At5g38830.1 68418.m04697 tRNA synthetase class I (C) family protein similar to SP|Q06752 Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA ligase) (CysRS) {Bacillus subtilis}; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 511 Score = 25.8 bits (54), Expect = 9.4 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 194 TAGVISLY-CGTSLYSFSYVG 135 T G I LY CG + Y FS++G Sbjct: 25 TPGKIGLYVCGITAYDFSHIG 45 >At5g27640.1 68418.m03311 eukaryotic translation initiation factor 3 subunit 9 / eIF-3 eta / eIF3b (TIF3B1) nearly identical to SP|Q9C5Z1 Eukaryotic translation initiation factor 3 subunit 9 (eIF-3 eta) (eIF3 p110) (eIF3b) {Arabidopsis thaliana} Length = 712 Score = 25.8 bits (54), Expect = 9.4 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -1 Query: 173 YCGTSLYSFSYVGLSNNTWLFNLSRTFPL--DHFFFLALPPPDPSF 42 Y T++ S + W FN + + DHFF LA P PSF Sbjct: 566 YVATAVTSVHEMENGFTIWSFNGIMLYRILKDHFFQLAWRPRPPSF 611 >At4g36670.1 68417.m05203 mannitol transporter, putative similar to mannitol transporter [Apium graveolens var. dulce] GI:12004316; contains Pfam profile PF00083: major facilitator superfamily protein Length = 493 Score = 25.8 bits (54), Expect = 9.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 185 VISLYCGTSLYSFSYVGLSNNTWLFNLSRTFPL 87 V+S+ S +F +GL TW+++ S FPL Sbjct: 377 VLSIVAAYSFVAFFSIGLGPITWVYS-SEVFPL 408 >At2g02810.1 68415.m00226 UDP-galactose/UDP-glucose transporter contains transmembrane domains; identical to UDP-galactose/UDP-glucose transporter (GI:22651763) [Arabidopsis thaliana] similar to UGTrel1 (GI:1669564) [Rattus rattus]; identical to cDNA UDP-galactose/UDP-glucose transporter GI:22651762 Length = 332 Score = 25.8 bits (54), Expect = 9.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 168 WDFLVQFLICGFIKQHLVVQLVTNF 94 WD L ++ ICG + Q+ + ++NF Sbjct: 245 WDIL-KYCICGAVGQNFIFMTISNF 268 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,379,125 Number of Sequences: 28952 Number of extensions: 171885 Number of successful extensions: 545 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 507810264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -