BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30019 (576 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37595| Best HMM Match : Ribosomal_S11 (HMM E-Value=0) 95 5e-20 SB_56400| Best HMM Match : MTS (HMM E-Value=0.44) 29 3.6 SB_15000| Best HMM Match : CRA_rpt (HMM E-Value=4) 27 8.3 >SB_37595| Best HMM Match : Ribosomal_S11 (HMM E-Value=0) Length = 543 Score = 94.7 bits (225), Expect = 5e-20 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 1/56 (1%) Frame = +3 Query: 102 LGPQHL-VGETVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDKRHP 266 LG +H+ GE VFGVAHIFASFNDTFVHVTDLSGRETI+RVTGGMKVKADRD+ P Sbjct: 187 LGWRHVGEGELVFGVAHIFASFNDTFVHVTDLSGRETISRVTGGMKVKADRDEASP 242 Score = 46.0 bits (104), Expect = 2e-05 Identities = 25/51 (49%), Positives = 27/51 (52%) Frame = +2 Query: 287 QDVAEKCKTLGITALHIKLRAXXXXXXXXXXXXAQXXXXXXXXXXMKIGRI 439 QDVA +CK +GITALHIKLRA AQ MKIGRI Sbjct: 250 QDVAARCKEIGITALHIKLRATGGNKTKTPGPGAQSALRALARSGMKIGRI 300 >SB_56400| Best HMM Match : MTS (HMM E-Value=0.44) Length = 230 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 141 VAHIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRD 254 + +I +FND + DLSG+ETI ++ K++ +RD Sbjct: 154 IIYIEDTFNDLLRTLRDLSGKETIVLIS--CKIRYERD 189 >SB_15000| Best HMM Match : CRA_rpt (HMM E-Value=4) Length = 433 Score = 27.5 bits (58), Expect = 8.3 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 69 NKVAKEEVQVTLGPQHLVGETVFGVAHIFASFNDTFVHVTD-LSGRETIARVTGGMKVKA 245 NK+ K +TLG + ET AH A N HVT+ GRE ++ KV A Sbjct: 329 NKLQKATDSMTLGANAISTETKPVGAHNMAGGNPRVQHVTNPRIGREVRSKAFAPAKVYA 388 Query: 246 D 248 + Sbjct: 389 E 389 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,311,491 Number of Sequences: 59808 Number of extensions: 363454 Number of successful extensions: 896 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -