BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30017 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 3.8 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 6.6 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 418 ILQFISFTLIT*LAMSKN---VLNDYIYIIVNEILLETKFSIDIT 543 ++ I+ T +T L + + V+ND I ++N+ T+F ++T Sbjct: 181 VVNTINLTFLTLLMILEGRFRVINDGIQALINDSRKVTRFPTELT 225 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 591 DLLSNSVPIKNLLKHLRNIYRK 526 DLL S + L+HLR ++ K Sbjct: 460 DLLVASETLNEHLEHLRQVFEK 481 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,436 Number of Sequences: 336 Number of extensions: 2749 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -