BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30016 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 26 1.0 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 3.1 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 5.4 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 7.2 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 9.5 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 26.2 bits (55), Expect = 1.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 573 MPDLDSSVPTTGYNNGVGM 517 +PD D S P+ GY N + M Sbjct: 367 LPDYDDSTPSNGYTNEIEM 385 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 3.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 33 FSKMSETLKLRGTLRGHNGWVTQ 101 F K+ E ++ LRG+ W+TQ Sbjct: 396 FQKLREKQQIEEDLRGYLDWITQ 418 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVL 367 SDG + +KT RLW RR+ + D++ Sbjct: 404 SDGKKPPNNPLEKTNRLWGGVINDIKRRYPMYKSDIM 440 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 595 INHLGHSGYLNTVTVSPDGSLCASGGKDMKAM 690 INH G++ N SL +GG+ + M Sbjct: 63 INHQGNAASANVAVADRQQSLILAGGRRQRIM 94 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 616 GYLNTVTVSPDGSLCASGGKDMKAMLWDLNDG 711 GYLN VS DG + +D K +DG Sbjct: 43 GYLNRKGVSCDGQTTINSCEDCKRKFGRCSDG 74 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 828,391 Number of Sequences: 2352 Number of extensions: 17225 Number of successful extensions: 40 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -