BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30016 (713 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 25 0.94 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 25 0.94 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.94 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 1.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.2 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.2 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 2.9 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 3.8 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 5.0 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 8.8 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.6 bits (51), Expect = 0.94 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -2 Query: 409 TRHYLTVVN*EGYREYILSMVLESS 335 +++Y+T+++ G+R++I +M+ +S Sbjct: 10 SKYYVTIIDAPGHRDFIKNMITGTS 34 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.6 bits (51), Expect = 0.94 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -2 Query: 409 TRHYLTVVN*EGYREYILSMVLESS 335 +++Y+T+++ G+R++I +M+ +S Sbjct: 26 SKYYVTIIDAPGHRDFIKNMITGTS 50 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.94 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -2 Query: 409 TRHYLTVVN*EGYREYILSMVLESS 335 +++Y+T+++ G+R++I +M+ +S Sbjct: 83 SKYYVTIIDAPGHRDFIKNMITGTS 107 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 1.2 Identities = 7/24 (29%), Positives = 19/24 (79%) Frame = -2 Query: 406 RHYLTVVN*EGYREYILSMVLESS 335 ++Y+T+++ G+R++I +M+ +S Sbjct: 84 KYYVTIIDAPGHRDFIKNMITGTS 107 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.6 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +3 Query: 132 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDVVLLVTVITHFPVLGTRLC 302 I+SS +KT+ +K + NNY K+LY + ++I + + V V ++ R Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPV--YYGNFPPRPM 138 Query: 303 VCGISLQARLP 335 IS+Q ++P Sbjct: 139 GPWISMQEQIP 149 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.6 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +3 Query: 132 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDVVLLVTVITHFPVLGTRLC 302 I+SS +KT+ +K + NNY K+LY + ++I + + V V ++ R Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPV--YYGNFPPRPM 138 Query: 303 VCGISLQARLP 335 IS+Q ++P Sbjct: 139 GPWISMQEQIP 149 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.6 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +3 Query: 132 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDVVLLVTVITHFPVLGTRLC 302 I+SS +KT+ +K + NNY K+LY + ++I + + V V ++ R Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPV--YYGNFPPRPM 138 Query: 303 VCGISLQARLP 335 IS+Q ++P Sbjct: 139 GPWISMQEQIP 149 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 189 NNYGIPQKRLYGHSHFISDVVLLVTVITHFPVLGTRLCVCGISLQARLP 335 NNY K+LY + ++I + + V V + R IS+Q ++P Sbjct: 342 NNYNNNYKKLYYNINYIEQIPVPVPVPIYCGNFPPRSMEPWISMQEQIP 390 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.4 bits (48), Expect = 2.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 519 MIGWNLTHDTQSLCPSSWMVY 457 ++GWN+ + P W+VY Sbjct: 20 LLGWNVPAEELIHIPEHWLVY 40 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 2.9 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 189 NNYGIPQKRLYGHSHFISDVVLLVTVITHFPVLGTRLCVCGISLQARLP 335 NNY K+LY + ++I + + V V + R IS+Q ++P Sbjct: 99 NNYNNYNKKLYYNINYIEQIPVPVPVPVYCGNFPPRPMGPWISIQEQIP 147 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +1 Query: 526 PIIVSCGWDRTVKVWHLTNCKLKINHLGHSGYLNTVTV 639 P +S W + W L CKL+ S Y++ +T+ Sbjct: 88 PFELSVFWQQYPWQWGLGICKLRAYVSETSSYVSVLTI 125 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/56 (23%), Positives = 27/56 (48%) Frame = +3 Query: 168 WKLTRDENNYGIPQKRLYGHSHFISDVVLLVTVITHFPVLGTRLCVCGISLQARLP 335 +K + NNY K+LY + ++I + + V V + +R + +Q ++P Sbjct: 96 YKYNYNNNNYNNNCKKLYYNINYIEQIPVPVPVPIYCGNFPSRPMGPWVPMQEQIP 151 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 8.8 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -3 Query: 471 SWMVYLHSARVFQSLIVLSREPDTI*RLSTEKATESTSLVW 349 SW + +F L++L+ +++ LS + ST+L W Sbjct: 2 SWQRVFLAVGLFGVLLLLTNADNSVHILSKYQLITSTTLNW 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,291 Number of Sequences: 438 Number of extensions: 4985 Number of successful extensions: 18 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -