BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30013X (352 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE006463-8|AAK61228.1| 156|Homo sapiens 60S ribosomal protein L... 29 5.5 X87248-1|CAA60698.1| 341|Homo sapiens HP8 peptide protein. 28 9.5 >AE006463-8|AAK61228.1| 156|Homo sapiens 60S ribosomal protein L23A like protein. Length = 156 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = -2 Query: 303 LTFPLPKPLKTRTRHSASWKPGTTMSRQRTLYIESCRFLFVNRQKNNRGEESNLQYYSI 127 LTF PK L+ R R WK +T R + + +F R EE+N +++ Sbjct: 44 LTFQRPKTLRRRRRPEYPWK--STPRRNKLGHYAVIKFPLTTESAVKRTEENNTLLFTV 100 >X87248-1|CAA60698.1| 341|Homo sapiens HP8 peptide protein. Length = 341 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 276 KTRTRHSASWKPGTTMSRQRTLYIESC 196 +TRTR +W P T SR RT C Sbjct: 178 RTRTRRPRTWPPRTCSSRSRTAARPPC 204 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,458,598 Number of Sequences: 237096 Number of extensions: 912039 Number of successful extensions: 1643 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1643 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 2084089752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -