BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30011 (620 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0058 - 4695400-4695648,4695846-4696112,4706026-4706430 28 6.9 09_06_0017 - 20248672-20248783,20248982-20249229,20249314-202494... 28 6.9 >10_02_0058 - 4695400-4695648,4695846-4696112,4706026-4706430 Length = 306 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 103 FPEHTAHLIVSGHRCSWTSAIP 38 FPE T HL+ S W S +P Sbjct: 116 FPERTMHLVCSSFSLHWLSKVP 137 >09_06_0017 - 20248672-20248783,20248982-20249229,20249314-20249480, 20249916-20250079,20251275-20251555 Length = 323 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -1 Query: 467 YRLVK*TFAFILI*L*FNYSLPCIGLKGWNGREGCH 360 Y+ V AF+L+ + F SL + KG NG +GCH Sbjct: 272 YQYVLWVVAFVLLLVGFVVSLVML-FKGKNGNDGCH 306 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,883,684 Number of Sequences: 37544 Number of extensions: 262061 Number of successful extensions: 505 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -