BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30007 (635 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 24 0.92 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 24 0.92 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 24 0.92 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 22 4.9 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 6.5 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 24.2 bits (50), Expect = 0.92 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = -2 Query: 328 SVRRRVFILTLDGENIDIINFLQGSDD*ALIPLSVSYPKLNPSGFTSVSERRMTASAS 155 ++ RRV + L + + D L+ + ++ PK++ G+T V+ +TAS + Sbjct: 309 NIARRVQVTLLQVNLSQVDPATRKEIDIFLVAIQMNPPKVSLKGYTVVNRELVTASVA 366 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 24.2 bits (50), Expect = 0.92 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = -2 Query: 328 SVRRRVFILTLDGENIDIINFLQGSDD*ALIPLSVSYPKLNPSGFTSVSERRMTASAS 155 ++ RRV + L + + D L+ + ++ PK++ G+T V+ +TAS + Sbjct: 309 NIARRVQVTLLQVNLSQVDPATRKEIDIFLVAIQMNPPKVSLKGYTVVNRELVTASVA 366 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 24.2 bits (50), Expect = 0.92 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = -2 Query: 328 SVRRRVFILTLDGENIDIINFLQGSDD*ALIPLSVSYPKLNPSGFTSVSERRMTASAS 155 ++ RRV + L + + D L+ + ++ PK++ G+T V+ +TAS + Sbjct: 309 NIARRVQVTLLQVNLSQVDPATRKEIDIFLVAIQMNPPKVSLKGYTVVNRELVTASVA 366 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.8 bits (44), Expect = 4.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 18 VLALCVCAVSAQE 56 +LA+C C V AQ+ Sbjct: 10 ILAICACTVFAQQ 22 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 503 TTPPPKKSGLYFEHHTLSISITSD 574 TTP P S L ++H S + T++ Sbjct: 266 TTPSPSASPLAYQHEYNSFNWTAN 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,939 Number of Sequences: 336 Number of extensions: 2411 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -