BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30007 (635 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0617 + 30383334-30383579,30383592-30383681,30383772-303839... 30 1.8 09_04_0541 + 18437075-18440062 28 5.4 02_05_0336 + 28033315-28033365,28033580-28033585,28033798-280338... 28 7.1 >02_05_0617 + 30383334-30383579,30383592-30383681,30383772-30383901, 30384578-30384591 Length = 159 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/69 (23%), Positives = 31/69 (44%) Frame = +2 Query: 368 YQPQSELLPVAPPMPEAIRRAIDYILAHPPKTETVKKL*IQKIQSTTPPPKKSGLYFEHH 547 Y+P+ P APP + A ++L PP + ++L + + PP ++S H Sbjct: 29 YRPRRPAAPTAPPGSRGL--AAQWLLPPPPPRRSHRRLIAPAVPAEFPPSRRSRHLVVHP 86 Query: 548 TLSISITSD 574 + + +D Sbjct: 87 FMDVFHVTD 95 >09_04_0541 + 18437075-18440062 Length = 995 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 460 DRNREKVINPEDSEHNAPAKEKWTLFR-APYVININNI 570 ++ R ++ + E+ EH+A + K LFR PY++ I+NI Sbjct: 521 EKERGRIRSFEEQEHDAFQRVKRELFRDVPYLLIIDNI 558 >02_05_0336 + 28033315-28033365,28033580-28033585,28033798-28033884, 28034741-28034830,28035736-28037778,28037916-28038062, 28038148-28038560,28038656-28038755 Length = 978 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +3 Query: 339 SSRIQLTRTDTNHRVSYFQLLLQCLKPSVALLTTFSLTH 455 +S Q ++++ +H S Q+ +C +PS+A + +S+TH Sbjct: 852 TSEFQQSKSNRDHHNSR-QVDRECTQPSIASMANYSVTH 889 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,854,851 Number of Sequences: 37544 Number of extensions: 276387 Number of successful extensions: 700 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -