BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30005 (434 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin relat... 32 0.21 U13643-5|AAA21081.1| 89|Caenorhabditis elegans Hypothetical pr... 28 3.4 AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical... 27 5.9 AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical ... 27 5.9 >AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin related. see also lmb-protein 1 protein. Length = 1067 Score = 31.9 bits (69), Expect = 0.21 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 94 SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 198 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 >U13643-5|AAA21081.1| 89|Caenorhabditis elegans Hypothetical protein T07E3.2 protein. Length = 89 Score = 27.9 bits (59), Expect = 3.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 351 DLFCFIWN*NAFKFLINLSMRCKKKKKK 434 DLF I+N F + L + CKKKK K Sbjct: 4 DLFVIIFNFCIITFSVYLGIGCKKKKNK 31 >AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 27.1 bits (57), Expect = 5.9 Identities = 19/62 (30%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = +1 Query: 79 EHGASSCISGKRGRRC---CNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFS 249 EH SC+SG G +C C + D ISG S G + +C L+ + Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-----HCSCQPGWRGKKCNRPCLKGYF 1249 Query: 250 GR 255 GR Sbjct: 1250 GR 1251 >AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 27.1 bits (57), Expect = 5.9 Identities = 19/62 (30%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = +1 Query: 79 EHGASSCISGKRGRRC---CNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFS 249 EH SC+SG G +C C + D ISG S G + +C L+ + Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-----HCSCQPGWRGKKCNRPCLKGYF 1249 Query: 250 GR 255 GR Sbjct: 1250 GR 1251 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,445,862 Number of Sequences: 27780 Number of extensions: 176355 Number of successful extensions: 335 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 735312162 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -