BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30005 (434 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16141.1 68417.m02446 expressed protein contains 1 predicted ... 30 0.77 At4g15840.1 68417.m02409 expressed protein 30 0.77 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 4.1 At5g07790.1 68418.m00892 expressed protein 27 5.5 At4g03610.1 68417.m00496 phosphonate metabolism protein-related ... 27 5.5 At3g01270.1 68416.m00033 pectate lyase family protein similar to... 26 9.5 >At4g16141.1 68417.m02446 expressed protein contains 1 predicted transmembrane domain; contains a partial Pfam PF00320: GATA zinc finger profile Length = 226 Score = 29.9 bits (64), Expect = 0.77 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = -1 Query: 365 KTEKVRSWSDVENG*CLASPHGVGATMAAAVNCDTMLRPL 246 K E SDV+NG C +S G G T V+C T PL Sbjct: 11 KLESAGDSSDVDNGNCSSSGSG-GDTKKTCVDCGTSRTPL 49 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.9 bits (64), Expect = 0.77 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 160 ISGSRARFQLSGNSGRKHSRCCTSILRKFSGRSIVS 267 +SGS FQ S NS R CTS++ K G S+V+ Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG-SVVA 149 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.5 bits (58), Expect = 4.1 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 70 KLKEHGASSCISGKRGRRCCNIWHWGSVDSISG 168 K+ EH ASS R N W GSV ISG Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457 >At5g07790.1 68418.m00892 expressed protein Length = 616 Score = 27.1 bits (57), Expect = 5.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 91 SSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSI 234 S + KR RR + G+ +S + A +S SGR+ + C TS+ Sbjct: 411 SGRVKRKRSRRISLVAE-GNYQQVSAAEAIVDISRKSGRETAACITSL 457 >At4g03610.1 68417.m00496 phosphonate metabolism protein-related weak similarity to PhnP protein. (Swiss-Prot:P16692) [Escherichia coli] Length = 290 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -1 Query: 164 LMESTDPQCHILQHRRPRLPLMQLEAPCS----FNFCSLRAIRRYKSYYVD*G 18 L++ +DP CH+ LP + C+ ++CS R+K +D G Sbjct: 30 LLQPSDPPCHVCSQSLSLLPHLNPNYRCNTSLLIDYCSKEEDGRHKYILIDVG 82 >At3g01270.1 68416.m00033 pectate lyase family protein similar to pectate lyase P59 SP:P15722 from [Lycopersicon esculentum] Length = 475 Score = 26.2 bits (55), Expect = 9.5 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 136 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFSGRSIVSQLTAAA 285 W+W S + + A F+ SGN K S +++ +G + VS+LT A Sbjct: 416 WNWRSEKDVFMNNAYFRQSGNPHFKCSHSRQQMIKPKNGMA-VSKLTKYA 464 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,871,276 Number of Sequences: 28952 Number of extensions: 164032 Number of successful extensions: 364 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -