BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30004 (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0) 78 5e-15 SB_21444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_35470| Best HMM Match : PAN (HMM E-Value=2.9e-08) 28 4.1 SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) 27 9.4 >SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0) Length = 115 Score = 77.8 bits (183), Expect = 5e-15 Identities = 38/63 (60%), Positives = 44/63 (69%) Frame = +3 Query: 255 KHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRI 434 K +VYRAK +T G K TKLR IWGKVTR HGNSG VRAKF+ NLP +AMG + Sbjct: 47 KRLAFVYRAKNKTVAKGDK--KATKLRVIWGKVTRAHGNSGVVRAKFRHNLPPKAMGATV 104 Query: 435 RVM 443 RV+ Sbjct: 105 RVI 107 Score = 57.6 bits (133), Expect = 6e-09 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = +1 Query: 133 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAG 255 RLY K + G+KRGLRNQH NT+L+K+EG +R + FY G Sbjct: 6 RLYTKGIVLGFKRGLRNQHPNTSLVKIEGVDERKNTEFYLG 46 >SB_21444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 29.1 bits (62), Expect = 2.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 409 GRLDLNLARTLPELPCGRVTLPQI 338 G DLN+ +T+P + C R+ P++ Sbjct: 257 GLFDLNIGQTIPSVTCRRIPFPEL 280 >SB_35470| Best HMM Match : PAN (HMM E-Value=2.9e-08) Length = 614 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -1 Query: 398 LELGSDTARVAMWAG----HLAPDSTQLGFFATGTSGNWC 291 L L TA + +W G HLA D + FATG S WC Sbjct: 12 LALRQPTASLNIWEGRAPPHLAVDGVNMSTFATG-STIWC 50 >SB_22619| Best HMM Match : TSP_1 (HMM E-Value=8.5e-14) Length = 506 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 276 RAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGS 380 R ++R P P PR + WG T GN+G+ Sbjct: 79 RRRRRRPPPCPPRNCAVSAWSSWGPCTHQCGNAGT 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,455,576 Number of Sequences: 59808 Number of extensions: 334045 Number of successful extensions: 785 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -