BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11054 (663 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 2.2 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 6.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.8 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 6.8 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/47 (23%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 83 APPGDDNDLAYRIRGHMNKLAPRTTTWHSENRTFYVPK-DLNTTSHV 220 +P G ++ +++ + GH + L+P T + + + Y P L+ + H+ Sbjct: 39 SPQGPNSPVSFSMGGHGSLLSPSGNTPNKSSTSPYPPNHPLSGSKHL 85 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 6.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 475 PDYYRP*LSVSGGST 519 P+Y +P L VS GST Sbjct: 186 PNYIKPQLHVSTGST 200 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +1 Query: 79 RSTPRRRQRPGISNTRTYEQTCPSNDYMAQRKPNLLR 189 R P R S+ + CPS + M + LLR Sbjct: 77 RDLPNSRCNSRESSDSLVQPRCPSGESMLSERAALLR 113 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 233 GPLRKSLDHHTLAP 274 GPLR S HH +P Sbjct: 35 GPLRTSYQHHFNSP 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,311 Number of Sequences: 336 Number of extensions: 3772 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -