BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11053 (312 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101318-5|AAC69347.1| 574|Caenorhabditis elegans Hypothetical ... 27 3.6 >AF101318-5|AAC69347.1| 574|Caenorhabditis elegans Hypothetical protein Y73C8C.7 protein. Length = 574 Score = 26.6 bits (56), Expect = 3.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 296 STLNFVYLIFKIIDIISARDQERPAPATRPGXRVCAL 186 S +F + F II++ SA+ P P PG C L Sbjct: 42 SKKDFRKIEFVIIEVTSAKFSATPIPTITPGGGYCVL 78 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,329,040 Number of Sequences: 27780 Number of extensions: 61753 Number of successful extensions: 174 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 344570176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -