BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11050 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 151 5e-37 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 140 7e-34 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 138 4e-33 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 123 1e-28 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 34 0.089 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 33 0.27 SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) 31 0.83 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 31 1.1 SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 31 1.1 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 31 1.1 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) 30 1.9 SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 29 3.4 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_7408| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_22778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) 29 4.4 SB_12881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_11098| Best HMM Match : Mak16 (HMM E-Value=5.1) 29 4.4 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_42043| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) 28 5.9 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 28 5.9 SB_54258| Best HMM Match : ubiquitin (HMM E-Value=0.00055) 28 5.9 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_36345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) 28 7.7 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 28 7.7 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 28 7.7 SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) 28 7.7 SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 28 7.7 SB_22514| Best HMM Match : Drf_FH1 (HMM E-Value=1.8) 28 7.7 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) 28 7.7 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 28 7.7 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 151 bits (366), Expect = 5e-37 Identities = 69/84 (82%), Positives = 78/84 (92%) Frame = +2 Query: 2 PPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEK 181 PPAPRGVPQIEVTFDIDANGILNVSA++KST KENKITITNDKGRLSKE+IERMVNEA K Sbjct: 467 PPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASK 526 Query: 182 YRNEDDKQKETIQAKNALESYCFS 253 Y+ ED+KQ++ IQ KN+LESY +S Sbjct: 527 YKEEDEKQRDRIQTKNSLESYAYS 550 Score = 97.5 bits (232), Expect = 8e-21 Identities = 40/63 (63%), Positives = 55/63 (87%) Frame = +1 Query: 256 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITK 435 KST+ED+K+K+KIS+ DK+ ILDKC + +KWLD+NQ A+K+E+E+ QKELE + NPIITK Sbjct: 552 KSTVEDDKVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITK 611 Query: 436 MYQ 444 +YQ Sbjct: 612 LYQ 614 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 140 bits (340), Expect = 7e-34 Identities = 64/84 (76%), Positives = 76/84 (90%) Frame = +2 Query: 2 PPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEK 181 PPAPRGVPQI+VTFD+D+NGILNVSA++KST KENKITITNDKGRLSKE+IERMV EAEK Sbjct: 559 PPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEK 618 Query: 182 YRNEDDKQKETIQAKNALESYCFS 253 ++ D+ +E IQ+KN+LESY FS Sbjct: 619 FKAADEAVRERIQSKNSLESYAFS 642 Score = 87.0 bits (206), Expect = 1e-17 Identities = 35/63 (55%), Positives = 51/63 (80%) Frame = +1 Query: 256 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITK 435 KSTMEDEK+K+K+S+ +++ ++ +C T+ WL+ NQ A+KEE + QKELEG+ NPIITK Sbjct: 644 KSTMEDEKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITK 703 Query: 436 MYQ 444 +YQ Sbjct: 704 LYQ 706 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 138 bits (334), Expect = 4e-33 Identities = 64/83 (77%), Positives = 73/83 (87%) Frame = +2 Query: 2 PPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEK 181 PPAPRGVPQIEVTFDIDANGILNVSA +KST K ITITNDKGRLSKEEI+RM+N+AEK Sbjct: 466 PPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEK 525 Query: 182 YRNEDDKQKETIQAKNALESYCF 250 Y++ED+ Q+E I A+N LESY F Sbjct: 526 YKSEDEAQREKIAARNRLESYAF 548 Score = 64.5 bits (150), Expect = 7e-11 Identities = 25/62 (40%), Positives = 44/62 (70%) Frame = +1 Query: 256 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITK 435 KS + + L+ K+S SDK T+ +K + + WL+ N LA+KEE+E ++KEL+ + +PI+ K Sbjct: 551 KSAISEPSLEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAK 610 Query: 436 MY 441 ++ Sbjct: 611 VH 612 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 123 bits (296), Expect = 1e-28 Identities = 56/84 (66%), Positives = 69/84 (82%) Frame = +2 Query: 2 PPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEK 181 PPAPRGVPQIEVTF+ID NGIL VSA +K T + KITITND+ RL+ E+IERMVN+AEK Sbjct: 1160 PPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEK 1219 Query: 182 YRNEDDKQKETIQAKNALESYCFS 253 + +ED K KE ++A+N LESY +S Sbjct: 1220 FADEDKKTKEKVEARNELESYAYS 1243 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/52 (34%), Positives = 34/52 (65%) Frame = +1 Query: 268 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNP 423 + EKL K+S+ DK+TI + I W+D NQ A E+++ ++++ + +Y+P Sbjct: 1250 DKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKRKWKMLYSP 1301 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 93.1 bits (221), Expect = 2e-19 Identities = 47/78 (60%), Positives = 57/78 (73%) Frame = +2 Query: 2 PPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEK 181 PPAPRGVPQ+EVTFDIDANGI+NVSA +K T +E +I I G LSK+ IE M+ EAEK Sbjct: 271 PPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVI-QSSGGLSKDAIENMIKEAEK 329 Query: 182 YRNEDDKQKETIQAKNAL 235 Y E DKQK+ + K + Sbjct: 330 YA-EADKQKKVEKLKEEI 346 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 34.3 bits (75), Expect = 0.089 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 2/68 (2%) Frame = +1 Query: 241 LLLQQKSTMED-EKLKEKISDSDKQTILDKCNDTIKWLDSN-QLADKEEYEHKQKELEGI 414 L+ K T+ D +K + + D+ + C++ +WL++N A EE ++++L G+ Sbjct: 742 LITSTKETIADPDKHMGRFTKDDRVSGNRYCDEKSEWLENNADTASLEEIVKQKEDLAGV 801 Query: 415 YNPIITKM 438 PI++K+ Sbjct: 802 LQPILSKL 809 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +2 Query: 77 AIEKSTNKENKITITNDKGRLSKEEIER--MVNEAEKYRNEDDKQKETIQAKNA 232 A +K+T+K + ITN G++ KEE +R V E++K K++E I+ K A Sbjct: 1132 AEQKATSKLQEEEITNAMGKIEKEEAKRKAAVEESQKAIEAARKKQEEIRQKQA 1185 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 33.1 bits (72), Expect = 0.21 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%) Frame = +1 Query: 250 QQKSTMEDEKLKEKISDS--DKQTILDKCNDTIKW-LDSNQLADKEEYEHKQKELEGIYN 420 Q+++ +E+++ EK DK+ L + T+K+ LD +LA KE++ +KE EG Sbjct: 95 QKRARVENDRDSEKHKRDLRDKEQELSELRKTVKYALDQEKLA-KEQFGDLKKEFEGYKK 153 Query: 421 PIITKM 438 + TKM Sbjct: 154 KMDTKM 159 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 32.7 bits (71), Expect = 0.27 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 83 EKSTNKENKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSR 256 +K+ + NKI + N+ + SKE++ER V AE + R+ D + K +++LE SR Sbjct: 1031 DKTRRQLNKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKGWRDIRSSLERDLQSR 1089 >SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 31.5 bits (68), Expect = 0.63 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 37 HLRHRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQ 144 H +H+ ++ Q+ +Y++ HQ Q H Q+Q+ Q Sbjct: 291 HQQHQLHQHQQQHQYQQQHQHQHQHQHQQQQQQQQQ 326 >SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) Length = 207 Score = 31.1 bits (67), Expect = 0.83 Identities = 15/67 (22%), Positives = 32/67 (47%) Frame = +1 Query: 229 CIGILLLQQKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 408 C+ + L +K M+ L +++ +K +D+ L+ + E EHK +ELE Sbjct: 46 CVDVSLSVRKKNMDILHLNDEVKRYEKLLAMDRKLPRRSILEERLGRAEAELEHKDRELE 105 Query: 409 GIYNPII 429 ++ ++ Sbjct: 106 NLHKQVV 112 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 31.1 bits (67), Expect = 0.83 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +2 Query: 68 NVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQ-AKNALES 241 NV A+E+S K + ++ + E+I+ + EAE+ E ++ E +Q KNALES Sbjct: 1268 NVKAVEESNEKITSLKALINQKDDALEKIKASLKEAEERFQELNRTLEEVQKEKNALES 1326 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +2 Query: 50 DANGILNV-SAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAK 226 +A+ + N+ A+EK+ +K + + + L ++ +VNE +K + + D QK+ I+ Sbjct: 1155 EASEVANLRDALEKANSK---VAHSEEILALKAARLKELVNELDKMKKDLDAQKQAIEES 1211 Query: 227 NALES 241 + ES Sbjct: 1212 RSEES 1216 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.1 bits (67), Expect = 0.83 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 328 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 438 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 44 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/60 (25%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = +1 Query: 253 QKSTMEDEKLKEKISDSDK-QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 429 QK ++E L++++S+ ++ Q ++++ N+T+K L +K+E K L+ +N ++ Sbjct: 26 QKVYSDNESLQKRVSELEEHQKVIEETNETLKKQHETVLFEKDELTLTIKTLQEEFNTML 85 >SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +2 Query: 53 ANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA 232 + I+ EK N EN++ K KEE+ + E+++ +K K+ ++ KN Sbjct: 165 SKSIIEKMKTEKK-NLENEVASLKLKQETIKEEVVEEIEGDEEFQKLQNKYKQVVEEKNT 223 Query: 233 LE 238 L+ Sbjct: 224 LQ 225 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 QIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQ 205 ++E+ I+ L A ++ ++T D G + EE++R+ NE EK +NE Sbjct: 99 EVELRKTIEQKEHLLQMAEKEIVKLREQLTSKADYGNIHAEELQRIRNELEKCKNEISDL 158 Query: 206 KETIQAKN-ALESY 244 + K+ L++Y Sbjct: 159 NSKLNTKSQKLKTY 172 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +2 Query: 116 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALE 238 + +K RL EE+ER+ E +K E+ K++ET++ K L+ Sbjct: 277 LEEEKKRL--EELERLKEEKDKMLEEELKKRETLEEKQKLQ 315 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 7/60 (11%) Frame = +1 Query: 256 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSN------QLADK-EEYEHKQKELEGI 414 K ++ +K ++ D +K+ +++C TIK LDSN Q+AD+ EE + ++ELE + Sbjct: 176 KLVVDLQKTRKAQDDCEKE--VNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESV 233 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +2 Query: 26 QIEVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQ 205 ++E+ I+ L A ++ ++T D G + EE++R+ NE EK +NE Sbjct: 99 EVELRKTIEQKEHLLQMAEKEIVKLREQLTSKADYGNIHAEELQRIRNELEKCKNEISDL 158 Query: 206 KETIQAKN-ALESY 244 + K+ L++Y Sbjct: 159 NSKLNTKSQKLKTY 172 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +2 Query: 86 KSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY 244 ++ N+E KI T +K + +E+IE E + NE+++++ET + + E Y Sbjct: 71 EAENEEEKIEET-EKEKDEEEKIEEEEKEGGEEENEEEEEEETEEEEEKEEEY 122 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/47 (34%), Positives = 30/47 (63%) Frame = +1 Query: 268 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 408 E E +KE + +++++ KC +T K LD+++ D+E+ E Q+E E Sbjct: 1077 EHETMKESLLNANREIGRLKCENTAKNLDADRKEDQED-EEVQREGE 1122 >SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) Length = 82 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +1 Query: 253 QKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 405 +K T ED++ ++K ++SD Q + N T K +L + +E K+ EL Sbjct: 32 KKVTQEDQEPEKKSNESDPQKDQETDNKTSKKESQEELREADETPKKKDEL 82 >SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 80 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 202 +E+ + K + DKG K ++E EKY E+DK Sbjct: 66 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 106 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 80 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 202 +E+ + K + DKG K ++E EKY E+DK Sbjct: 78 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 118 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 80 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 202 +E+ + K + DKG K ++E EKY E+DK Sbjct: 90 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 130 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 80 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 202 +E+ + K + DKG K ++E EKY E+DK Sbjct: 102 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 142 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 80 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 202 +E+ + K + DKG K ++E EKY E+DK Sbjct: 114 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 154 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 80 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 202 +E+ + K + DKG K ++E EKY E+DK Sbjct: 126 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 166 >SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +2 Query: 119 TNDKGRLSKEEIERMVNEAEKY-RNEDDKQKETIQAKNALE 238 TND G S +E E VN ++K NE++ + E ++ +N++E Sbjct: 888 TNDNGS-STDEAESEVNNSDKEGENEENDEVEDMEVENSIE 927 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 125 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA 232 ++ + KEE ER+ EAE+ R ED++Q+ + + A Sbjct: 411 EEEKRQKEEEERLRVEAERQREEDERQRAEDERQRA 446 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 125 DKGRLSKEEIERMVNEAEKYRNEDDKQKE 211 DK +L KEE E+ + E NE KQKE Sbjct: 1606 DKYQLEKEEAEKRLQSYEDELNEKQKQKE 1634 >SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +1 Query: 253 QKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 402 ++S EDE+ E SD D +T +++ +D ++ D+EE HK +E Sbjct: 113 EESGDEDEEKTESESDDDDKTEKYSDDESDVSMDGDESDDEEEGPHKPEE 162 >SB_7408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 3.4 Identities = 23/94 (24%), Positives = 41/94 (43%) Frame = +1 Query: 55 QRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQKRG*QAKGDHPGQECI 234 QR QR R R+ H+Q ++ QRQR + R R + ++R Q + Q Sbjct: 36 QRQRQRQRQRQRHRQRQRQRQRQRQRQRQRQRQRQ----RQRQRQRQRQRQRQRQRQRLR 91 Query: 235 GILLLQQKSTMEDEKLKEKISDSDKQTILDKCND 336 L+Q+ ++ + +D+D + D +D Sbjct: 92 QRQRLRQRQRQRQQQRNDNDNDNDNRNDNDHDHD 125 >SB_22778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Frame = +1 Query: 85 EVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQKRG*QAKGDHPGQEC-IGILLLQQKS 261 E +Q +D HY+R S + +D A +E+Q++ +A +E + I +Q+K+ Sbjct: 363 ETERQNARDSHYERIHSMHKLQDEA-----KEMQQKEIEAVRVRMLRERELEIEKVQEKA 417 Query: 262 TMEDEKLKEKISDSD 306 E + L+ K+ D+D Sbjct: 418 RREADNLERKVQDAD 432 >SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) Length = 1558 Score = 28.7 bits (61), Expect = 4.4 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 3/86 (3%) Frame = +1 Query: 175 REVQKRG*QAKGDHPGQ---ECIGILLLQQKSTMEDEKLKEKISDSDKQTILDKCNDTIK 345 REVQ+R A DH + + +L L DE+ E++ ++ Q D + Sbjct: 205 REVQRRN-DASMDHAAALPADVVAVLTLFDA----DERAHEELHNTAHQKFTDAIT---R 256 Query: 346 WLDSNQLADKEEYEHKQKELEGIYNP 423 + D Q A++ +Y ++ +EL+G NP Sbjct: 257 FFDKLQ-AEETKYNNRMEELQGALNP 281 >SB_12881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 914 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 235 GILLLQQKSTMEDEKLKEKISDSDKQTILDKCNDT 339 G L +S EDEK+ SDS+ + LD C+ T Sbjct: 250 GSLFNTSRSASEDEKISLHFSDSEGSSSLDHCSLT 284 >SB_11098| Best HMM Match : Mak16 (HMM E-Value=5.1) Length = 460 Score = 28.7 bits (61), Expect = 4.4 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 4/83 (4%) Frame = +2 Query: 32 EVTFDIDANGILNVSAIEKSTNKENKITITNDKGRLSK--EEIERMVN--EAEKYRNEDD 199 E+ D++ + + + + + + N + R K +E++ +VN E E + D Sbjct: 338 EIEDDLEWDALRKSCSASNQSEQTDNYPDDNYEDREGKVDDELDEIVNFVEEEVHLQSDF 397 Query: 200 KQKETIQAKNALESYCFSRSLPW 268 +KE I +N + + SRSL W Sbjct: 398 GEKEVIFEENKSQDFTGSRSLCW 420 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +2 Query: 71 VSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEK---YRNEDDKQKETIQAK 226 V IEK + K I + KEEIE ++ EK EDD +KE I + Sbjct: 145 VEEIEKREDANEKEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDER 199 >SB_42043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 49 RCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQGRD 153 R QRY + + RE HQ+G HH R S + RD Sbjct: 134 RDQRY-RDYEDRERHQRGRDRHHRDRDDSGCRFRD 167 >SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) Length = 271 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/53 (26%), Positives = 31/53 (58%) Frame = +1 Query: 250 QQKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 408 ++++ E E +EK ++++K+ +K +T K + + A+ ++ KQKE E Sbjct: 187 EKEAQTEKEAEREKEAETEKEAKTEKEAETEKEAQTEKEAETQKEAEKQKEAE 239 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/56 (30%), Positives = 33/56 (58%) Frame = +2 Query: 74 SAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 241 S+++ S NK+ K+ K ++ K+++++ E ++ DDK KET+ N +ES Sbjct: 212 SSMKLSKNKKKKMK-KKLKKQIEKQKLQQDEIEQGLLQDSDDKDKETL-GDNCIES 265 >SB_54258| Best HMM Match : ubiquitin (HMM E-Value=0.00055) Length = 411 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Frame = +2 Query: 68 NVSAIEKSTNKENKITITNDKGRLSKE-EIERMVN---EAEKYRNEDDKQKET 214 N+ + EK+ +K+ +TN++ SKE ++ N E + +N DD+Q++T Sbjct: 46 NLDSEEKTEDKQTASDLTNEENAESKEITADQPTNNELETDNAQNVDDQQQQT 98 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/68 (30%), Positives = 25/68 (36%) Frame = -1 Query: 508 HLRLRVLRPGSPAYLRGLLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNPAT*WCRC 329 HL +RVL P P L LS C CLP+ +C H + P C Sbjct: 1140 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVHLSVRVLSPVCPRVFTCLY 1195 Query: 328 TCRGWSAC 305 C S C Sbjct: 1196 ACVNLSVC 1203 >SB_36345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = +1 Query: 223 QECIGILLLQQKSTMEDEKLKEKI---SDSDKQTILDKC 330 ++C+ I ++ +EDE LKE + D+DK+ ++D C Sbjct: 87 RQCMPIAQKREVEQIEDEDLKEMMRQQDDNDKRFLIDTC 125 >SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) Length = 592 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +1 Query: 67 QRFRYREVHQQGEQD-HHYQRQRSSLQGRDRAYG**GREVQKRG*QAKGDHPG 222 +R+R R+V Q+GE++ H+Q + + D R+V +RG + + HPG Sbjct: 200 RRYRTRQVSQRGERERRHHQEWQYAATVLD-------RQVSERGKRERRHHPG 245 Score = 27.9 bits (59), Expect = 7.7 Identities = 20/79 (25%), Positives = 39/79 (49%) Frame = +1 Query: 67 QRFRYREVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQKRG*QAKGDHPGQECIGILL 246 +R+R R+V Q+GE++ + + + R R+V +RG + + HPG + I Sbjct: 395 RRYRTRQVSQRGERERRHHPGVAICRYRT-------RQVSQRGKRERRHHPG---VAICR 444 Query: 247 LQQKSTMEDEKLKEKISDS 303 + + T E + K++ S Sbjct: 445 YRTRQTGESTRRTRKMTSS 463 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/64 (25%), Positives = 33/64 (51%) Frame = +1 Query: 211 DHPGQECIGILLLQQKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEH 390 D P + + +L + ++ EKLKE I D K +LD+ ++W+ + ++ + Sbjct: 847 DPPSISALDLYVLIPPANIK-EKLKEDIHDPHK--VLDRVKYRVEWVKHQEKEKQKLEDE 903 Query: 391 KQKE 402 ++KE Sbjct: 904 REKE 907 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 143 KEEIERMVNEAEKYRNEDDKQKETIQAKNALES 241 K E+E+ E EK R E +KQ+ + K LES Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILES 137 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = +2 Query: 125 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA 232 +K R +EE +++ + +K+ ++ K+ E ++ KNA Sbjct: 50 EKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNA 85 >SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) Length = 332 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +2 Query: 68 NVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQ--KETIQAKNALES 241 NVS + K K++ + GR K ++ + EK++ + K+ +E Q K A++ Sbjct: 100 NVSVLVKPDCKQDAVKEQKPSGRKLKRKLYKQRKRQEKFKKIEKKKAIREQKQQKAAIQR 159 Query: 242 Y 244 Y Sbjct: 160 Y 160 >SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) Length = 1482 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 235 GILLLQQKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLAD 372 G LL +ED L + + D T+LD +D++ LD + D Sbjct: 1037 GATLLDDVDVVEDVGLLDDVDVVDGATLLDDVDDSVTLLDDVDVVD 1082 >SB_22514| Best HMM Match : Drf_FH1 (HMM E-Value=1.8) Length = 336 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 167 NEAEKYRNEDDKQKETIQAKNALESYCFSRS 259 + + R ED+K KE IQ ALE Y SR+ Sbjct: 75 SRCSRVRCEDEKLKELIQRLLALEKYVASRN 105 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 283 KEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQ 396 +EK ++T D+ N TI +L+ EE++HK+ Sbjct: 1693 REKWRKEYEKTTQDEINKTISYLEDQYTRGLEEFKHKE 1730 >SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) Length = 436 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 16 WRASN*GHLRHRCQRYPQRFRYREVHQQGEQDHHYQRQRSSLQ 144 WR N GH++ R Q P +Y+ + + + H QR L+ Sbjct: 246 WRRQNHGHIQSRTQVQPSSQQYKTLPSE-QSSPHKMSQREPLK 287 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 143 KEEIERMVNEAEKYRNEDDKQKETIQAKNALES 241 K E+E+ E EK R E +KQ+ + K LES Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILES 255 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,194,096 Number of Sequences: 59808 Number of extensions: 376908 Number of successful extensions: 1815 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1801 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -