BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11046 (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomy... 26 4.4 SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schiz... 26 5.8 >SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 26.2 bits (55), Expect = 4.4 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = -2 Query: 620 PEWTQDTARSRGLHYARSKMIYSLTIRNLFLKIKTADITLGKQTKINFNTSLH*FIFLLN 441 P WT+ A S +Y +++ S R F++ + Q + FNTS F+ Sbjct: 7 PGWTEHKAPSGIPYYWNAELKKSTYQRPSFIEKNHSSSVTASQASLAFNTSEKLFVNENA 66 Query: 440 ESECRAQGFNKQI 402 E ++ KQ+ Sbjct: 67 EERKNSRDLRKQL 79 >SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 25.8 bits (54), Expect = 5.8 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 139 IYKYGVDFL*DKKTIALFKIVTCLQQSLAYILSVFTT 29 I+KY +DF+ K++ L+K T ++ L V +T Sbjct: 263 IFKYAIDFMPRSKSMELYKEYTHFEKQFGDHLGVEST 299 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,583,534 Number of Sequences: 5004 Number of extensions: 50557 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -