BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11046 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 3.6 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.3 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 3.6 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 226 MYKCKIIVTILYLVHSNIHLGISLTFNEYIHSI--CKYFVEN 345 +YK K TILY+V + L ++ F Y H CK +E+ Sbjct: 145 LYKDK---TILYMVKLTLKLSCAMNFLIYPHDTQECKLQMES 183 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 59 VSVHFKCFYNALGFDI 12 +S FK FY+A FDI Sbjct: 108 MSALFKLFYHAKDFDI 123 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 59 VSVHFKCFYNALGFDI 12 +S FK FY+A FDI Sbjct: 108 MSALFKLFYHAKDFDI 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,124 Number of Sequences: 438 Number of extensions: 3220 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -