BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11045 (779 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.6 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 7.4 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.7 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 574 LTAQTTLWYIVHEGAGPAPPPQTE*LTSSAI 482 LTA ++ + A P PP +E T S+I Sbjct: 337 LTAMMHHLHVAKQMASPEPPKSSESSTGSSI 367 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 103 NSIRAPSPDTDSPAPERXHTKVASETS 23 +S R+PSP + P + H K S+ + Sbjct: 39 SSSRSPSPSLLTSQPHQDHNKEKSKNN 65 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 250 PRPRPPALSSAGP 288 P P PP SS+GP Sbjct: 341 PAPPPPPPSSSGP 353 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,696 Number of Sequences: 438 Number of extensions: 5646 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -