BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11033 (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 26 1.4 AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-l... 25 1.8 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 25 3.2 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 25 3.2 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 25 3.2 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 25 3.2 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 25 3.2 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 24 4.3 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 24 4.3 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 24 5.6 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 24 5.6 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 7.4 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 23 9.8 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 23 9.8 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 9.8 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 9.8 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 23 9.8 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 25.8 bits (54), Expect = 1.4 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 4/72 (5%) Frame = -2 Query: 372 LPVVGERLILLATCFNASTFMLLFNVGLMMNSLSF----ASVLKTVETGRALFRRCQVPW 205 LP V + + LL T FN FM+ +V L + L++ A + + +++F + +PW Sbjct: 284 LPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQ-WLPW 342 Query: 204 SLMLLKKERKHT 169 L + + RK T Sbjct: 343 ILRMGRPGRKIT 354 >AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-like 3 protein protein. Length = 269 Score = 25.4 bits (53), Expect = 1.8 Identities = 14/63 (22%), Positives = 33/63 (52%) Frame = +3 Query: 87 LLVRSLSTSVASAQMVKPPVQVFGLEGRYASALFSAASKTKALDIVEKELGQFQQSSKLM 266 L++ S+ + + A+MVK Q G +GR + + L ++ + ++Q ++L+ Sbjct: 36 LVLHSMLVNASLAEMVKESYQTHGADGRMVVRMLKF---VRLLPGADERVAVYKQLAELL 92 Query: 267 QSS 275 +S+ Sbjct: 93 KSN 95 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNIVANAGSNG 59 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNIVANAGSNG 59 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNTATNGNIVANAGSNG 59 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNTATNGNIVANAGSNG 59 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAITNTATNGNIVANAGSNG 59 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 26 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 61 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNIVANAGSNG 59 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN ++ + T GN++ NG Sbjct: 24 PAKKTSSTANATTGAANAVTNTATNGNIVANAGSNG 59 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENGRLDKLEAVIN 430 P K S +A AN ++ + T GN + NG + + A N Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNSVANAGSNGTGNNVIAATN 69 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENGRLDKLEAVIN 430 P K S +A AN ++ + T GN + NG + + A N Sbjct: 24 PAKKTSSTANATTGAANAVTNNATNGNSVANAGSNGTGNNVIAATN 69 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 163 SNPNTCTGGFTICAEATL 110 SNPN C G+ C E ++ Sbjct: 86 SNPNQCPIGYETCREISI 103 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 26 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 61 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 293 PTLKRSMKVDALKHVANKISLSPTTGNLLGLLAENG 400 P K S +A AN I+ + T GN + NG Sbjct: 24 PAKKTSSTANATTGAANAITNNATNGNSVANAGSNG 59 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 366 VVGERLILLATCFNASTFMLLF 301 ++ RL+ L CFN TF+ F Sbjct: 41 ILALRLVTLLPCFNVLTFISSF 62 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 464 EVTCEVVTAKPLDQARGKIWKQRLRN 541 E +V T PLD + K K+RLRN Sbjct: 571 EKMLDVETFLPLDYLQKKPLKERLRN 596 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 23.0 bits (47), Expect = 9.8 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +2 Query: 92 GSLFEHKCRL--STNGKTSSASIWIGRSVCFRSFFSSIKDQGT*HRRKRARPVSTVFKTD 265 GS ++C L ST G+ + ++ G +F+ + G R+R R T ++T Sbjct: 176 GSWNTNQCSLTGSTGGQAAPST---GLHQSNHTFYPWMAIAGANGLRRRGRQTYTRYQTL 232 Query: 266 AKLKEFIINPTLKRSMKVD 322 KEF N L R +++ Sbjct: 233 ELEKEFHTNHYLTRRRRIE 251 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,638 Number of Sequences: 2352 Number of extensions: 14360 Number of successful extensions: 95 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -