BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11030 (782 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1347 + 32803664-32803796,32803891-32804093,32804202-328043... 29 5.5 >04_04_1347 + 32803664-32803796,32803891-32804093,32804202-32804383, 32804514-32804798,32804901-32804959,32805052-32805088, 32805186-32805257,32805336-32806005 Length = 546 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 683 NDILPCVVVLCISETFNRSEPRFVFIVETVYRVCITL 573 +DILPCV V +E+ RSE V +V V V + + Sbjct: 347 DDILPCVDVATANESMYRSEEVTVQLVALVNNVIVNI 383 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,873,500 Number of Sequences: 37544 Number of extensions: 248211 Number of successful extensions: 414 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -