BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11029 (596 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 135 3e-32 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 4e-29 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 109 2e-24 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 101 3e-22 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 34 0.076 SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) 33 0.13 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 33 0.13 SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) 33 0.18 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 33 0.23 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 33 0.23 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 33 0.23 SB_21463| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_33252| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 31 0.53 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 31 0.71 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 31 0.71 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 31 0.71 SB_22758| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 31 0.93 SB_49479| Best HMM Match : R3H (HMM E-Value=0.0079) 31 0.93 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_16304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 30 1.2 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) 30 1.6 SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) 30 1.6 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 30 1.6 SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) 30 1.6 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 30 1.6 SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_28185| Best HMM Match : FIVAR (HMM E-Value=2.2) 29 2.2 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 29 2.2 SB_1048| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 29 2.9 SB_2140| Best HMM Match : DUF1154 (HMM E-Value=1) 29 2.9 SB_1024| Best HMM Match : Ank (HMM E-Value=0) 29 2.9 SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) 29 3.8 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) 29 3.8 SB_26314| Best HMM Match : SURF6 (HMM E-Value=2.8) 29 3.8 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 29 3.8 SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) 28 5.0 SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_35075| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) 28 5.0 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 28 5.0 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 28 5.0 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 5.0 SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) 28 5.0 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 28 5.0 SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) 28 6.6 SB_21673| Best HMM Match : Troponin (HMM E-Value=0.34) 28 6.6 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 28 6.6 SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) 28 6.6 SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) 28 6.6 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 28 6.6 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 28 6.6 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 28 6.6 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 28 6.6 SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) 28 6.6 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 27 8.7 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) 27 8.7 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 27 8.7 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_8472| Best HMM Match : TatC (HMM E-Value=1.4) 27 8.7 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 135 bits (326), Expect = 3e-32 Identities = 63/99 (63%), Positives = 81/99 (81%) Frame = +1 Query: 4 SVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYC 183 +VSA++KST KENKITITNDKGRLSKE+IERMVNEA KY+ ED+KQ++ IQ KN+LESY Sbjct: 489 NVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYA 548 Query: 184 FSMKSTMEDEKLKEKISDSDKQTISTSATTPSSGWIPTS 300 +SMKST+ED+K+K+KIS+ DK+ I T W+ T+ Sbjct: 549 YSMKSTVEDDKVKDKISEEDKKAILDKCTEVLK-WLDTN 586 Score = 68.5 bits (160), Expect = 4e-12 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +3 Query: 255 LDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 380 LDKC + +KWLD+NQ A+K+E+E+ QKELE + NPIITK+YQ Sbjct: 573 LDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 124 bits (300), Expect = 4e-29 Identities = 56/84 (66%), Positives = 74/84 (88%) Frame = +1 Query: 4 SVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYC 183 +VSA++KST KENKITITNDKGRLSKE+IERMV EAEK++ D+ +E IQ+KN+LESY Sbjct: 581 NVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYA 640 Query: 184 FSMKSTMEDEKLKEKISDSDKQTI 255 FSMKSTMEDEK+K+K+S+ +++ + Sbjct: 641 FSMKSTMEDEKVKDKLSEDEREKV 664 Score = 59.3 bits (137), Expect = 2e-09 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +3 Query: 255 LDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 380 + +C T+ WL+ NQ A+KEE + QKELEG+ NPIITK+YQ Sbjct: 665 ISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 706 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 109 bits (262), Expect = 2e-24 Identities = 50/84 (59%), Positives = 66/84 (78%) Frame = +1 Query: 4 SVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYC 183 +VSA +KST K ITITNDKGRLSKEEI+RM+N+AEKY++ED+ Q+E I A+N LESY Sbjct: 488 NVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYA 547 Query: 184 FSMKSTMEDEKLKEKISDSDKQTI 255 F +KS + + L+ K+S SDK T+ Sbjct: 548 FGVKSAISEPSLEGKLSQSDKDTV 571 Score = 46.0 bits (104), Expect = 2e-05 Identities = 16/40 (40%), Positives = 30/40 (75%) Frame = +3 Query: 258 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMY 377 +K + + WL+ N LA+KEE+E ++KEL+ + +PI+ K++ Sbjct: 573 NKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 101 bits (243), Expect = 3e-22 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 2/115 (1%) Frame = +1 Query: 7 VSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCF 186 VSA +K T + KITITND+ RL+ E+IERMVN+AEK+ +ED K KE ++A+N LESY + Sbjct: 1183 VSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAY 1242 Query: 187 SMKSTMED-EKLKEKISDSDKQTISTSATTPSSGWIPTSWPTR-RSMSTSRKNWK 345 S+K+ + D EKL K+S+ DK+TI T A + W+ + ++ WK Sbjct: 1243 SLKNQVGDKEKLGGKLSEDDKKTI-TEAVEKAISWMDKNQDASVEDFKKEKRKWK 1296 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +3 Query: 276 IKWLDSNQLADKEEYEHKQKELEGIYNP 359 I W+D NQ A E+++ ++++ + +Y+P Sbjct: 1274 ISWMDKNQDASVEDFKKEKRKWKMLYSP 1301 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 2/86 (2%) Frame = +1 Query: 4 SVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY- 180 +VSA +K T +E +I I + G LSK+ IE M+ EAEKY E DKQK+ + K + Sbjct: 293 NVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYA-EADKQKKVEKLKEEIAKVR 350 Query: 181 -CFSMKSTMEDEKLKEKISDSDKQTI 255 + K E +++ S+ ++++ Sbjct: 351 EVLANKDNETGETIRQAYSELQQKSL 376 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 44.0 bits (99), Expect = 9e-05 Identities = 30/108 (27%), Positives = 54/108 (50%), Gaps = 2/108 (1%) Frame = +1 Query: 22 KSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 201 K E+K ++ K++ + E + DD + +AKNALES+ F ++ Sbjct: 674 KKEGDESKSEGKKEEPTADKDKKAEKADGKEAPKARDDAKAANERAKNALESHIFGVRDE 733 Query: 202 MEDEKLKEKIS-DSDKQTISTSATTPSSGWI-PTSWPTRRSMSTSRKN 339 M E L EK+S +++++TIS A T +S W+ W + ++ + N Sbjct: 734 MNSE-LGEKLSTEAERETIS-EALTAASDWLDEDGWDSTANVYNEKLN 779 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 35.9 bits (79), Expect = 0.025 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 1/93 (1%) Frame = +1 Query: 4 SVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESY 180 +V A+E+S K + ++ + E+I+ + EAE+ E ++ E +Q KNALES Sbjct: 1268 NVKAVEESNEKITSLKALINQKDDALEKIKASLKEAEERFQELNRTLEEVQKEKNALESK 1327 Query: 181 CFSMKSTMEDEKLKEKISDSDKQTISTSATTPS 279 + T + E L K SD +K+ ATT S Sbjct: 1328 IEEL--TQKSETLMGKHSDKEKEL--EKATTES 1356 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +1 Query: 1 TSVSAIEKSTNKEN-KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 177 + V+ + + K N K+ + + L ++ +VNE +K + + D QK+ I+ + ES Sbjct: 1157 SEVANLRDALEKANSKVAHSEEILALKAARLKELVNELDKMKKDLDAQKQAIEESRSEES 1216 Query: 178 YCFSMKSTMEDEKLKE 225 + ME EKLKE Sbjct: 1217 ---GIIGEME-EKLKE 1228 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 34.3 bits (75), Expect = 0.076 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 9/104 (8%) Frame = +1 Query: 10 SAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFS 189 S+++ S NK+ K+ K ++ K+++++ E ++ DDK KET+ N +ES Sbjct: 212 SSMKLSKNKKKKMK-KKLKKQIEKQKLQQDEIEQGLLQDSDDKDKETL-GDNCIESNDME 269 Query: 190 MKSTMEDEKLKEKISD---------SDKQTISTSATTPSSGWIP 294 + E++ E++S SD++T + TP G P Sbjct: 270 ESAKDSSEEISEELSSRLLEEQCVVSDEETRKCNKITPQDGEEP 313 >SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) Length = 298 Score = 33.5 bits (73), Expect = 0.13 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +1 Query: 61 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 240 +K R KEE ER+ E+ R E+ +++E K E K EK ++++ Sbjct: 94 EKRRREKEEEERLKRAEEEKRREEKRREE----KRREEELKRERKEQERREKERQRLEKE 149 Query: 241 DKQT-ISTSATTPSSG 285 K+ +S TTPS G Sbjct: 150 KKEIGFKSSTTTPSKG 165 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMK 195 +K+ + NKI + N+ + SKE++ER V AE + R+ D + K +++LE S Sbjct: 1031 DKTRRQLNKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKGWRDIRSSLERDLQSRD 1090 Query: 196 STMED 210 +++D Sbjct: 1091 HSIDD 1095 >SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Frame = +1 Query: 1 TSVSAIEK----STNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA 168 +S S IEK N EN++ K KEE+ + E+++ +K K+ ++ KN Sbjct: 164 SSKSIIEKMKTEKKNLENEVASLKLKQETIKEEVVEEIEGDEEFQKLQNKYKQVVEEKNT 223 Query: 169 LESYCFSMKSTMED 210 L+ +++ +E+ Sbjct: 224 LQGELDGLQTQLEE 237 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +1 Query: 13 AIEKSTNKENKITITNDKGRLSKEEIER--MVNEAEKYRNEDDKQKETIQAKNA 168 A +K+T+K + ITN G++ KEE +R V E++K K++E I+ K A Sbjct: 1132 AEQKATSKLQEEEITNAMGKIEKEEAKRKAAVEESQKAIEAARKKQEEIRQKQA 1185 >SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) Length = 1596 Score = 33.1 bits (72), Expect = 0.18 Identities = 18/82 (21%), Positives = 45/82 (54%), Gaps = 1/82 (1%) Frame = +1 Query: 31 NKENKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMKSTME 207 +K + + N+ L E +E +++ + + NE+++++E + +++ S + E Sbjct: 329 SKAGNMAVGNENETLDHEIVEETMSDPDPEEENEEEEEEEEEDLVDPMDAIRESCEEKPE 388 Query: 208 DEKLKEKISDSDKQTISTSATT 273 KLK ++S+ +++ S S+TT Sbjct: 389 CSKLKLELSNCEERVNSKSSTT 410 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 32.7 bits (71), Expect = 0.23 Identities = 35/144 (24%), Positives = 55/144 (38%), Gaps = 4/144 (2%) Frame = +1 Query: 79 KEEIERMVNEAEKYRNEDDKQKET-IQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 255 K + E+ E E E ++ +E I K E K E KL+E S+K+ Sbjct: 596 KRKEEKAQRERELIEQEKNRAREIYISLKRVREQV--KQKEAEEQRKLEEAWQRSEKKAK 653 Query: 256 STSATTPSSGWIPTSWPTR-RSMSTSRKNW--KAFTIR*LRRCTRVPEESPEVCRASRAE 426 +S I S R R+++ R+N + I ++P + V + SRA Sbjct: 654 EAERDRRNSVSIARSEVLRERALAAKRRNTMGQKIVIEAPHTPPQIPTRTGSVNKPSRAP 713 Query: 427 HPEPEVPPPGLEALAPPSRRSIKP 498 P P P P + +S P Sbjct: 714 PPVPNHPSPAVPLRREGDTKSFAP 737 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/62 (29%), Positives = 35/62 (56%) Frame = +1 Query: 61 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 240 ++ + KEE ER+ EAE+ R ED++Q+ + + A E +K M+ K + + ++ Sbjct: 411 EEEKRQKEEEERLRVEAERQREEDERQRAEDERQRA-EDERQRVKHEMQRLKDERRRAEE 469 Query: 241 DK 246 D+ Sbjct: 470 DE 471 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/76 (23%), Positives = 41/76 (53%), Gaps = 4/76 (5%) Frame = +1 Query: 34 KENKITITNDKGRLSKEE---IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM 204 +E + T ++ R ++EE I R EAE+ R E +++++ + +ALE C + Sbjct: 501 EEKRRKETEERERQAREEEDRIRREREEAERLRREKEQREQLVPHSDALE--CAIKPLNL 558 Query: 205 EDEKLK-EKISDSDKQ 249 + ++K +K+ + ++ Sbjct: 559 LEARIKAQKLEEEQRE 574 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/85 (23%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = +1 Query: 16 IEKSTNKENKITITNDK-GRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALE-SYCFS 189 +E+ TN++NK+ + K + +++ ++ E + + D+ +E+ +AK + Sbjct: 430 LEEVTNEKNKLNLEIQKMQKQHNDDMAELIKRFEDEKMKLDEARESEKAKTTQHLTKAER 489 Query: 190 MKSTMEDEKLKEKISDSDKQTISTS 264 + S ME+ KLK K + +K ++ T+ Sbjct: 490 VLSEMEEIKLKMKAIEQEKLSLQTT 514 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 32.7 bits (71), Expect = 0.23 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQK--ETIQAKNALESYCFS 189 +EK KE K +K RL K++ E +K + E++K+K E I AK + Sbjct: 355 LEKQAEKEKK-----EKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKKREE 409 Query: 190 MKSTMEDEKLKEK 228 K E+EK+K+K Sbjct: 410 KKKQEEEEKMKKK 422 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +1 Query: 79 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 228 K+E ER+ +AEK + K+KE ++ K E K E+EK K++ Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKKE 394 >SB_21463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 32.3 bits (70), Expect = 0.31 Identities = 24/78 (30%), Positives = 33/78 (42%) Frame = +1 Query: 220 KEKISDSDKQTISTSATTPSSGWIPTSWPTRRSMSTSRKNWKAFTIR*LRRCTRVPEESP 399 +E+ + + SAT+ SS SWPT S RK+ TIR RR ++P Sbjct: 799 REETDSLTRVNRTPSATSSSSSESSGSWPTSGFGSLDRKD-DGSTIRTKRRQHKLPATPV 857 Query: 400 EVCRASRAEHPEPEVPPP 453 E R E+ PP Sbjct: 858 EKPRRGSGSTTSSEIVPP 875 >SB_33252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 31.9 bits (69), Expect = 0.40 Identities = 27/108 (25%), Positives = 50/108 (46%) Frame = +1 Query: 169 LESYCFSMKSTMEDEKLKEKISDSDKQTISTSATTPSSGWIPTSWPTRRSMSTSRKNWKA 348 LE+ + + E+ +E + ++Q++ TP + IP P R SMS + + + Sbjct: 64 LENQRLENQRLLRREEEEENTKEEERQSVEEPLGTPLA-MIP---PKRPSMSATLRPSQT 119 Query: 349 FTIR*LRRCTRVPEESPEVCRASRAEHPEPEVPPPGLEALAPPSRRSI 492 R + T+ ++ A+ A P P PP G+ A A S+R++ Sbjct: 120 AIARRGKTLTKKKKKKT----ATAAGFPPPTQPPRGMTATARKSKRNV 163 >SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 31.5 bits (68), Expect = 0.53 Identities = 21/91 (23%), Positives = 39/91 (42%) Frame = +1 Query: 22 KSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 201 K KENK +K + +KE ++ +K +N DK KE N + K Sbjct: 468 KDKTKENKDKTKENKDK-TKENKDKTKENKDKTKNNKDKTKENKDKTNENKDKTKENKDK 526 Query: 202 MEDEKLKEKISDSDKQTISTSATTPSSGWIP 294 ++ K K K + + + ++ T ++ +P Sbjct: 527 TKENKNKTKENKTANRPLTPLPATTANRLLP 557 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 31.5 bits (68), Expect = 0.53 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = +1 Query: 22 KSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFS 189 K ++++K DKG K++ E ++ E +++ + +KE Q+ K ES C S Sbjct: 1513 KGESEKDKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCES 1572 Query: 190 MKSTMEDEKLKEKISDSDKQ 249 K E EK E+ D + + Sbjct: 1573 EKEKCESEKKVEESKDENPE 1592 Score = 31.1 bits (67), Expect = 0.71 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKE--EIERMVNEAEKYRNEDDKQK-ETIQAK-NALESYCF 186 +K ++++K DKG K+ E E+ E+EK + + +K+K E+ + K + + C Sbjct: 1519 DKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCE 1578 Query: 187 SMKSTME--DEKLKEKISDSDKQTIS 258 S K E DE +EKI + T S Sbjct: 1579 SEKKVEESKDENPEEKIEEKKDDTAS 1604 Score = 31.1 bits (67), Expect = 0.71 Identities = 18/82 (21%), Positives = 40/82 (48%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 198 +K ++++K DKG KE+ + + E + + + +KE +++ +E K Sbjct: 1533 DKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVE----ESKD 1588 Query: 199 TMEDEKLKEKISDSDKQTISTS 264 +EK++EK D+ + +S Sbjct: 1589 ENPEEKIEEKKDDTASEKKESS 1610 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 31.5 bits (68), Expect = 0.53 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = +1 Query: 22 KSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFS 189 K ++++K DKG K++ E ++ E +++ + +KE Q+ K ES C S Sbjct: 92 KGESEKDKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCES 151 Query: 190 MKSTMEDEKLKEKISDSDKQ 249 K E EK E+ D + + Sbjct: 152 EKEKCESEKKVEESKDENPE 171 Score = 31.1 bits (67), Expect = 0.71 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKE--EIERMVNEAEKYRNEDDKQK-ETIQAK-NALESYCF 186 +K ++++K DKG K+ E E+ E+EK + + +K+K E+ + K + + C Sbjct: 98 DKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCE 157 Query: 187 SMKSTME--DEKLKEKISDSDKQTIS 258 S K E DE +EKI + T S Sbjct: 158 SEKKVEESKDENPEEKIEEKKDDTAS 183 Score = 31.1 bits (67), Expect = 0.71 Identities = 18/82 (21%), Positives = 40/82 (48%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 198 +K ++++K DKG KE+ + + E + + + +KE +++ +E K Sbjct: 112 DKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVE----ESKD 167 Query: 199 TMEDEKLKEKISDSDKQTISTS 264 +EK++EK D+ + +S Sbjct: 168 ENPEEKIEEKKDDTASEKKESS 189 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.1 bits (67), Expect = 0.71 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 264 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 374 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 44 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 31.1 bits (67), Expect = 0.71 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +1 Query: 43 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 216 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 31.1 bits (67), Expect = 0.71 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 264 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 374 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 772 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 809 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 31.1 bits (67), Expect = 0.71 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +1 Query: 43 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 216 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_22758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 30.7 bits (66), Expect = 0.93 Identities = 20/91 (21%), Positives = 45/91 (49%) Frame = +1 Query: 28 TNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTME 207 T++ NK+ N KG ++ + V ++N++ + + A++ + F + + Sbjct: 118 TSQYNKLEKPNKKGLSFLQKTQSSV----MHKNKEKQDYSSTSARSQKDPEVFVISDEED 173 Query: 208 DEKLKEKISDSDKQTISTSATTPSSGWIPTS 300 +EK ++ +KQ ST+ +TP + W +S Sbjct: 174 EEKRQDSRPQMNKQAQSTNISTPFN-WAKSS 203 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 30.7 bits (66), Expect = 0.93 Identities = 20/70 (28%), Positives = 31/70 (44%) Frame = +1 Query: 100 VNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTISTSATTPS 279 + E + N+DD + A + K +D+K K KI D DK+ T+ +TPS Sbjct: 126 IEEPAEEANDDDNDDFALSASSGKNK-----KKDKKDKKQKNKIDD-DKEDKLTNTSTPS 179 Query: 280 SGWIPTSWPT 309 P P+ Sbjct: 180 ENVSPDKLPS 189 >SB_49479| Best HMM Match : R3H (HMM E-Value=0.0079) Length = 605 Score = 30.7 bits (66), Expect = 0.93 Identities = 29/120 (24%), Positives = 60/120 (50%), Gaps = 10/120 (8%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKE---EIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCF 186 +K+ N E+ I+ T + + +++ +I+ + + + + + ET + +K A +S Sbjct: 314 KKNKNAESSISKTKENAKSNRKRSPKIQAAILQKIDSLPDTESENETFRFSKTANKSKPV 373 Query: 187 SMKSTMEDEKLK---EKIS-DSDKQTISTSATTPS--SGWIPTSWPTRRSMSTSRKNWKA 348 K++ ++K K E++S D DK + + T P S PT+ R+S ST ++ A Sbjct: 374 VNKTSKSNQKEKTDEERLSGDKDKDVVQVNPTIPKPKSSKKPTTSTKRQSTSTETQSTSA 433 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/62 (24%), Positives = 34/62 (54%) Frame = +1 Query: 43 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 222 K+ I +D G L ++ N+ +K + E+D+ +E + E++ SM+ + D++ + Sbjct: 975 KVKIYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEET----EAHIISMQEEVNDDETE 1030 Query: 223 EK 228 E+ Sbjct: 1031 EE 1032 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +1 Query: 52 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALE 174 + +K RL EE+ER+ E +K E+ K++ET++ K L+ Sbjct: 277 LEEEKKRL--EELERLKEEKDKMLEEELKKRETLEEKQKLQ 315 >SB_16304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1489 Score = 30.7 bits (66), Expect = 0.93 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 25 STNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM 204 +++ E + N + RL + E + +V+ AEK + +QKE ++ N+L ++ T Sbjct: 55 TSDLETLLASCNRRMRLLETETKILVDWAEKKDKKIVRQKE-LEILNSLSNFKRGRPLTE 113 Query: 205 EDEKLKEKISDS-DKQTISTSATTPSSG 285 E K+KI DS K + ++ T G Sbjct: 114 ERGSKKQKIDDSTSKGGVQSAGRTKGLG 141 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = +1 Query: 34 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 213 KE K ++ +EE ER E K E+ KQ+E + K E + E+E Sbjct: 433 KERKKREAEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEE 487 Query: 214 KLKEKISDSDKQ 249 + K+K + +K+ Sbjct: 488 ERKQKEKEEEKK 499 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +1 Query: 79 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQ 249 KE+I+ NEA++ + DK +KE +KN LES +K+ ++ +E I+ ++Q Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQ 60 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +1 Query: 22 KSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY 180 ++ N+E KI T +K + +E+IE E + NE+++++ET + + E Y Sbjct: 71 EAENEEEKIEET-EKEKDEEEKIEEEEKEGGEEENEEEEEEETEEEEEKEEEY 122 Score = 29.1 bits (62), Expect = 2.9 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +1 Query: 31 NKENKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMKSTME 207 NK+NK K K+E E V E + NE++K +ET + K+ E K E Sbjct: 42 NKKNKNKNKKKKKMKKKKEEEAEVGEKTLEAENEEEKIEETEKEKDEEEKIEEEEKEGGE 101 Query: 208 DEKLKEKISDSDKQ 249 +E +E+ +++++ Sbjct: 102 EENEEEEEEETEEE 115 >SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) Length = 732 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 2/81 (2%) Frame = +1 Query: 10 SAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK--QKETIQAKNALESYC 183 SA++ TNK+ + + R+ E ER+ E K E K QKE AK LE Sbjct: 179 SAMDAGTNKKVEEEERLTRARIQAEAAERLAKEVTKTLEELRKTMQKELEDAKVKLEQEK 238 Query: 184 FSMKSTMEDEKLKEKISDSDK 246 +++ KE+ S+ ++ Sbjct: 239 KDSVKKLKERLEKERESEEER 259 >SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) Length = 818 Score = 29.9 bits (64), Expect = 1.6 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 2/91 (2%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 198 EKS NKE + + +K SK + E N+ E+ +N+++K+ + + K A +S Sbjct: 450 EKSKNKEEE---SKNKEEKSKNKEEESKNKEEESKNKEEKRAKK-KGKVADAGQPSEERS 505 Query: 199 TMEDEKLKEKISDSDKQTISTSAT--TPSSG 285 ++ K K + D + ++ T PS+G Sbjct: 506 VGDENKAGNKNENQDTKPLTEPETIDQPSTG 536 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = +1 Query: 43 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 222 K+ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 448 KVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 503 Query: 223 EK 228 E+ Sbjct: 504 EE 505 >SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) Length = 1693 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +1 Query: 220 KEKISDSDKQTISTSATTPSSGWIPTSWPTRRSMSTSRKNW 342 +E +S+S + T++T+ T+ S+ + P+R S S+ +W Sbjct: 53 REAVSNSPRPTLATTPTSGSNAIAVAAGPSRASSSSKASSW 93 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = +1 Query: 43 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 222 K+ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 87 KVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 142 Query: 223 EK 228 E+ Sbjct: 143 EE 144 >SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Frame = +1 Query: 241 DKQTISTSATTPSSG-WIPTSWPTRRSMSTSRKNWKAFTIR*LRRCTRVPEESPEVCRAS 417 D T +T+ T P + P S+P S S S+K W+ L+R ++ E Sbjct: 27 DHNTRTTTWTDPRTNKQTPVSFPAASSQSISQKPWQQSPTSTLQRTSQTNNELSNALNTH 86 Query: 418 RAEHPEPEVPP 450 P PP Sbjct: 87 PKRWPPVNTPP 97 >SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 138 +E+ + K + DKG K ++E EKY E+DK Sbjct: 66 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 106 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 138 +E+ + K + DKG K ++E EKY E+DK Sbjct: 78 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 118 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 138 +E+ + K + DKG K ++E EKY E+DK Sbjct: 90 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 130 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 138 +E+ + K + DKG K ++E EKY E+DK Sbjct: 102 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 142 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 138 +E+ + K + DKG K ++E EKY E+DK Sbjct: 114 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 154 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 138 +E+ + K + DKG K ++E EKY E+DK Sbjct: 126 LEEDKGNKEKYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 166 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = +1 Query: 43 KITITNDKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKL 219 K + G+ S ++ +E+E E+ K+KE AK +S K ++E Sbjct: 102 KAPVAKTSGKNSAKKAAESSSESESESEEEAPKKKEAPVAKQNGKS-----KKAKKEESS 156 Query: 220 KEKISDSDKQTISTSATTPS 279 E SDSD++T + T P+ Sbjct: 157 SESDSDSDEETPTPKKTVPA 176 >SB_28185| Best HMM Match : FIVAR (HMM E-Value=2.2) Length = 106 Score = 29.5 bits (63), Expect = 2.2 Identities = 21/80 (26%), Positives = 45/80 (56%), Gaps = 4/80 (5%) Frame = +1 Query: 4 SVSAIEKSTNKENKIT-ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA-LES 177 SVS ++ + N + ++ + K +L+ E++E + +NE K+KET+ A + L+ Sbjct: 3 SVSYLQINNNLKGEVRELYESKSKLA-EQLENSRQLIKSIKNEHKKEKETLTALTSDLQQ 61 Query: 178 YCFSMKSTMEDEK--LKEKI 231 + K T++ E+ L++K+ Sbjct: 62 KLGAAKDTLDRERRTLRDKL 81 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 29.5 bits (63), Expect = 2.2 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Frame = +1 Query: 7 VSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEK---YRNEDDKQKETIQAKNALES 177 V IEK + K I + KEEIE ++ EK EDD +KE I + Sbjct: 145 VEEIEKREDANEKEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDER----- 199 Query: 178 YCFSMKSTMEDEKLKEKISDSDK 246 + E+E+++E+ D D+ Sbjct: 200 -----EDDNEEEEIEEREDDDDE 217 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/70 (24%), Positives = 34/70 (48%) Frame = +1 Query: 61 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 240 +K R +EE +++ + +K+ ++ K+ E ++ KNA E++ LK K S+S Sbjct: 50 EKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKSLKGKTSNS 104 Query: 241 DKQTISTSAT 270 + T Sbjct: 105 SAKMTRAQIT 114 >SB_1048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 29.5 bits (63), Expect = 2.2 Identities = 39/145 (26%), Positives = 60/145 (41%), Gaps = 7/145 (4%) Frame = +1 Query: 82 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIST 261 E + ++E E + + D + + K E + S M +K E + DSD Q + Sbjct: 223 ESLHERLSEVEPAKRKKDFRYALLDPKQKEE-----LLSQMLVQKTLESV-DSDLQNWPS 276 Query: 262 SATTPSSGWIPTSWPTRRSMSTSRKNWKA-FTIR*LRRCTRVPEESPEVCRASRAEHPEP 438 + TT +G + +RRS +SRK KA L R+P RAS E E Sbjct: 277 NFTTEKTGTKEQA-SSRRSRPSSRKQSKASLNSASLSSIPRLPPIQSASVRASSTEDREG 335 Query: 439 ------EVPPPGLEALAPPSRRSIK 495 E P L+++ PS+ K Sbjct: 336 KSKYSLESPVTSLKSVPEPSKPDSK 360 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = +1 Query: 61 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 240 DK +L KEE E+ + E NE KQKE +A++ L++ + D K E D+ Sbjct: 1606 DKYQLEKEEAEKRLQSYEDELNEKQKQKE--KAEDNLKALKKRISDLEVDNKNLETARDN 1663 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/86 (23%), Positives = 42/86 (48%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMK 195 +++S +K N++ DK + + + + A N D K+K+ + ++ LE + +K Sbjct: 86 LQRSVDKLNELLEEADKLKDVVSQKDEKI--AVLSTNHDFKEKQLRETESRLEDFKNEVK 143 Query: 196 STMEDEKLKEKISDSDKQTISTSATT 273 KLK+K D + ++S + T Sbjct: 144 KLQHTIKLKDKKIDGLESSLSETENT 169 >SB_2140| Best HMM Match : DUF1154 (HMM E-Value=1) Length = 155 Score = 29.1 bits (62), Expect = 2.9 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 198 E E+K++ G+ KE I E + E +Q ETI ++ E Sbjct: 72 ENELKHEHKMSTEEALGQQRKELIHEKNKELDGLNKEHQRQIETIVEQHGKEIDVM---- 127 Query: 199 TMEDEKLKEKI-SDSDK 246 T E+ LKEK+ S SDK Sbjct: 128 TKENASLKEKLKSTSDK 144 >SB_1024| Best HMM Match : Ank (HMM E-Value=0) Length = 891 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 385 PEESP--EVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 501 PE+ P EV A R E P+ E PP +PP ++ KPT Sbjct: 771 PEQPPIGEVESAVRREQPKSEKTPPSTTP-SPPPKQPSKPT 810 >SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +1 Query: 55 TNDKGRLSKEEIERMVNEAEKY-RNEDDKQKETIQAKNALE 174 TND G S +E E VN ++K NE++ + E ++ +N++E Sbjct: 888 TNDNGS-STDEAESEVNNSDKEGENEENDEVEDMEVENSIE 927 >SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) Length = 571 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Frame = +1 Query: 61 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTME-DEKLKEKISD 237 +KG + E+ ++ E Y+ + K+ + L +YCF + E+L D Sbjct: 341 NKGLFKQSEVLSLMRENVAYKLQHGHAKDAVDMLEKLHNYCFRNQGNQRYSERLPPLEGD 400 Query: 238 S--DKQTISTSATT 273 S D + TS T Sbjct: 401 SAMDVDALETSQLT 414 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/66 (27%), Positives = 34/66 (51%) Frame = +1 Query: 37 ENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 216 +NK T + + K+E R+ +EAEK E++K K+ + + + Y ++ + K Sbjct: 454 QNKDAATRYRVK-KKDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEVYQTK 512 Query: 217 LKEKIS 234 K+K S Sbjct: 513 QKQKES 518 >SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/74 (22%), Positives = 33/74 (44%) Frame = +1 Query: 58 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 237 +D ++ EE E ++AE E D++ +A ++ S +D++L EK+ D Sbjct: 975 SDASHVTSEE-EMQASDAESEEKEKDEESSDAEAPSSSRKRVISSD---DDDELDEKLDD 1030 Query: 238 SDKQTISTSATTPS 279 D + P+ Sbjct: 1031 DDDNNDDEEESKPT 1044 >SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) Length = 761 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/82 (21%), Positives = 38/82 (46%) Frame = +1 Query: 28 TNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTME 207 T K+N +TIT K K ++R++ ++ ++ +++T +++ E S T Sbjct: 188 TEKDNILTITETKKAEPKIFVKRIMGTEKRTKDVSRPEQDTEESEAPSEIPSLSPPPTAV 247 Query: 208 DEKLKEKISDSDKQTISTSATT 273 + + D T+ST + T Sbjct: 248 GYSTDKSVIDMVMATVSTGSQT 269 >SB_26314| Best HMM Match : SURF6 (HMM E-Value=2.8) Length = 222 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/74 (20%), Positives = 35/74 (47%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 198 +K K ++ +D+ + +E E+ +E EK +ED++ + + + + C+ Sbjct: 63 DKDEKKHDEDEKNHDEDEKNHDEDEKNHDEDEKNHDEDEENHDEDEKNHDEDDKCYDEDR 122 Query: 199 TMEDEKLKEKISDS 240 E + +E S+S Sbjct: 123 VEEPQSGQESASES 136 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/96 (22%), Positives = 39/96 (40%), Gaps = 1/96 (1%) Frame = +1 Query: 19 EKSTNKENKITITN-DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMK 195 +K ++KE K +K R+ KEE + E+ E +K+K + K + E + Sbjct: 126 DKKSDKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEKTKKEEKESREKEKTKKE 185 Query: 196 STMEDEKLKEKISDSDKQTISTSATTPSSGWIPTSW 303 EK K+K + + T + +SW Sbjct: 186 EKESKEKDKQKKDPPSGKLEKRDSMTSLTAHTKSSW 221 >SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) Length = 384 Score = 28.3 bits (60), Expect = 5.0 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +1 Query: 22 KSTNKENKIT-ITNDKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMK 195 + T K+ I DK + + EE+ VNEA K E KQ++T Q+ + + C Sbjct: 142 RMTPKDQHIVQALQDKVKFNLEELYHSVNEATKRNTEAIQKQRQTRQSPASPGTICRLYN 201 Query: 196 STMEDEKLKEKISDSDK 246 ++ E+ S++ K Sbjct: 202 KKLDFEQFDYGFSETIK 218 >SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/96 (19%), Positives = 40/96 (41%) Frame = +1 Query: 214 KLKEKISDSDKQTISTSATTPSSGWIPTSWPTRRSMSTSRKNWKAFTIR*LRRCTRVPEE 393 K+ EK + D +P +S P++ S + + K + ++ ++ + Sbjct: 413 KIAEKPEEPDLWVKRDDLPSPKRSPRTSSPPSKSPFSPTTDSDKKHPLSAIKPKGKIADA 472 Query: 394 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 501 + + +A R E +PE PP + +P + K T Sbjct: 473 TAQPAKADRKEAHDPEPPPEKTDGTSPTAEAYEKIT 508 >SB_35075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 4 SVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQK 144 S A + + ++ +K T N RLS + ER E KY + D+ K Sbjct: 616 SKQAQDNTRSRTHKFTPKNKLKRLSGIKTERQKTERHKYHKKPDRDK 662 >SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) Length = 888 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/62 (22%), Positives = 33/62 (53%) Frame = +1 Query: 43 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 222 ++ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 618 EVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 673 Query: 223 EK 228 E+ Sbjct: 674 EE 675 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 79 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 246 K E+E+ E EK R E +KQ+ + K LES E+ K+ I D++K Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILES------KQKRIEESKDTIHDNEK 154 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/78 (23%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMK 195 E+ + E ++ ++GR EE+E+ V A ++ +DK ++T + AL + K Sbjct: 869 ERIQDLEGELCHAKEEGRSLSEELEKAVEGARDIEHDLNDKLEQTSKRYEALLDE-LTAK 927 Query: 196 STMEDEKLKEKISDSDKQ 249 E +L+E+++ ++++ Sbjct: 928 LETEKMELQERLTKNNEE 945 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 28.3 bits (60), Expect = 5.0 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 9/149 (6%) Frame = +1 Query: 34 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQ-KETIQAKNALESYCFSMKSTMED 210 K+ ++ + RL +EI+R E+ R+ D +Q +E +AK +E S +T + Sbjct: 70 KQRALSDYERRRRLIDQEIDRRQEES---RSLDRRQAREWEEAKARIERLQQSQMATQQQ 126 Query: 211 EK------LKEKISDSDKQTISTS--ATTPSSGWIPTSWPTRRSMSTSRKNWKAFTIR*L 366 ++ L+ K+ +S S AT PT + + K A ++R + Sbjct: 127 QRGNVVSVLRNGQDKKPKKQVSFSNVATEIREPTSPT-YIVGSGEGVTAKITPAASVRLV 185 Query: 367 RRCTRVPEESPEVCRASRAEHPEPEVPPP 453 TR+P+ESPE R ++PPP Sbjct: 186 N--TRMPDESPEPTRPPPPLDDLDDLPPP 212 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/77 (20%), Positives = 35/77 (45%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 198 E+ +E ++ ++ +EE E E E+ E++++KE + + E + Sbjct: 196 EEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEE 255 Query: 199 TMEDEKLKEKISDSDKQ 249 E+EK + K + K+ Sbjct: 256 EEEEEKRRRKKKEKQKK 272 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +1 Query: 82 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 246 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) Length = 2261 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAE--KYRNEDDKQKETIQAKNALESYCFS 189 +EKS +NK DK R + +I + + K RNE +QKE + K +++ + S Sbjct: 368 LEKSRQAKNKQQEMMDKIRDATVKIPKPPGSRKSGKSRNELRRQKEAEEVKKSIDEFEAS 427 Query: 190 MKSTM 204 M++ + Sbjct: 428 MRANI 432 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 79 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 246 K E+E+ E EK R E +KQ+ + K LES E+ K+ I D++K Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILES------KQKRIEESKDTIHDNEK 272 >SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94) Length = 592 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 3 QRFRYREVHQQGEQD-HHYQRQRSSLQGRDRAYG**GREVQKRG*QAKGDHPG 158 +R+R R+V Q+GE++ H+Q + + D R+V +RG + + HPG Sbjct: 200 RRYRTRQVSQRGERERRHHQEWQYAATVLD-------RQVSERGKRERRHHPG 245 >SB_21673| Best HMM Match : Troponin (HMM E-Value=0.34) Length = 337 Score = 27.9 bits (59), Expect = 6.6 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 1/86 (1%) Frame = +1 Query: 79 KEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTI 255 K E++ EAEKY+ + D + E + K+A+E Y + + L E S+S+K I Sbjct: 137 KVELKDKTREAEKYQRQIKDNESEIQRLKDAIE-YRDNWLAE-RGLNLYEDNSESNKDEI 194 Query: 256 STSATTPSSGWIPTSWPTRRSMSTSR 333 + + I S + S S SR Sbjct: 195 NVFESLREGSTIDESGSEKSSFSESR 220 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 27.9 bits (59), Expect = 6.6 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 4/81 (4%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNED----DKQKETIQAKNALESYCF 186 ++ KE K+ I +K K++ ER+ + EK + ++ K+KE + ++ L Sbjct: 933 KEKKEKEKKLLIEKEKREKEKQK-ERLREKEEKEKQKEAERAKKEKERLLQEDKLHEKEE 991 Query: 187 SMKSTMEDEKLKEKISDSDKQ 249 + E K++++ + DKQ Sbjct: 992 KDRKDKEKRKVEKEKREKDKQ 1012 >SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) Length = 837 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMK 195 ++ T + K + +EE E AE DD Q++ +A ALE+ S+K Sbjct: 139 VQARTQGGRGVVANETKTVVQREEAEAAKKAAETQAIADDAQRDLDEALPALEAALASLK 198 Query: 196 S 198 S Sbjct: 199 S 199 >SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) Length = 762 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/72 (22%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +1 Query: 34 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMED 210 ++ I + N K + ++E+E+ E ++ + ++T+Q K A L ++K E+ Sbjct: 1 RDKTIGVLNSKVKNMQQELEQYKKELQESLSISTVMEQTLQVKEASLIQAEETLKELQEN 60 Query: 211 EKLKEKISDSDK 246 ++ EK+ +K Sbjct: 61 QQYIEKVEQLEK 72 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.9 bits (59), Expect = 6.6 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 4/78 (5%) Frame = +1 Query: 16 IEKSTNKENKITITNDKGRLSK-EEIERMVNEAEKYRNEDDKQKETI--QAKNALESYCF 186 I K+ +E K+ + +K + S+ E++E+ NEAEK N K+KE + + E Sbjct: 160 ISKNELEEKKLGL--EKKKTSEIEDLEKERNEAEKKYNSLRKEKENLVSELTKKFEMLEG 217 Query: 187 SMKSTMEDEK-LKEKISD 237 S +E+ K L++ + D Sbjct: 218 QKSSLVEENKVLQDSVKD 235 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 430 PEPEVPPPGLEALAPPSRRSIKP 498 P+P+ PPPG PPS + P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPP 50 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 27.9 bits (59), Expect = 6.6 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 1/132 (0%) Frame = +1 Query: 97 MVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTISTSATTP 276 M + E+ + + K++E Q + E +++ + E LKE + + +K+TI Sbjct: 182 MRKKEEERMSRERKERERRQQEFIKEQKDVAVQQKAQQESLKETLQEQEKETIQ-QLEED 240 Query: 277 SSGWIPTSWPTRRSMSTSRKNWKAFTIR*LRRCTRVPEESPEVCRA-SRAEHPEPEVPPP 453 + + T+ + K+FT++ + +RV + ++ A +R E E Sbjct: 241 FKAQLNELEVEKAKEQTALEEMKSFTVKSIILFSRVYSKYKDILEARNRQRKREREEELE 300 Query: 454 GLEALAPPSRRS 489 +E + R++ Sbjct: 301 RIERVEEMQRKT 312 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/65 (27%), Positives = 30/65 (46%) Frame = +1 Query: 22 KSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 201 K K+NK+ + E E + N+ ++ +DDK++ET K + + S Sbjct: 24 KKKEKKNKLAAL----AAAVEAAEEVENKMDEMSVKDDKREETQSDKKSAKESTKSSSKP 79 Query: 202 MEDEK 216 EDEK Sbjct: 80 AEDEK 84 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +1 Query: 82 EEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 237 E+ E+++ + AEK R +K+KE + E F + + +DE L +K+ D Sbjct: 1446 EKREKVLQDGAEKDRKGFEKEKEEFEEAFRKEKKIFQDELSKKDEDLAQKLQD 1498 >SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) Length = 643 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/70 (28%), Positives = 30/70 (42%) Frame = +1 Query: 70 RLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQ 249 R S EE+ R E E E K +ETIQ N E MK + D+ ++ + Sbjct: 380 RASVEELVRTRKELEMKEKELQKAQETIQQMNEREQ---QMKERLADQAQRQLRKGGKFE 436 Query: 250 TISTSATTPS 279 +S + P+ Sbjct: 437 DLSEADCRPT 446 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 27.5 bits (58), Expect = 8.7 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = +1 Query: 1 TSVSAIEKSTNKENKITITNDKGRLSK-EEIERMVNEAEKYRNED-DKQKETIQAKNALE 174 TS +EK + ++ +K + + E++ E E+Y +QKE + K + Sbjct: 92 TSKDKLEKDYALKAEVLRVKEKETVERLHRQEQLQLERERYATASLTQQKEALSEKLSQI 151 Query: 175 SYCFSMKSTMEDEKLKEKIS 234 + ++KS E+ K KEK+S Sbjct: 152 TLRQNLKSHKEEAKNKEKLS 171 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 256 STSATTPSSGWIPTSWPTRRSMSTSRKNWKA 348 S S P SGW + TRR+ T +K WKA Sbjct: 1201 SRSEVHPDSGWKTWTAMTRRTQKTCKK-WKA 1230 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -3 Query: 444 HLRLRVLRPGSPAYLRGLLRHPGTSS*LSDCKCLPILSACAH 319 HL +RVL P P L LS C CLP+ +C H Sbjct: 1140 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVH 1177 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -3 Query: 444 HLRLRVLRPGSPAYLRGLLRHPGTSS*LSDCKCLPILSACAH 319 HL +RVL P P L LS C CLP+ +C H Sbjct: 1177 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVH 1214 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 109 AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD-SDKQ 249 AEKY +E ++K+ ++ LES + + E L++K+S+ S+K+ Sbjct: 2091 AEKYEHESQEKKKIVEISETLESKNRKQQELL--ESLEKKLSEFSEKE 2136 >SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) Length = 325 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = +1 Query: 34 KENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY 180 K+ +I N + ++ KE+ +M+ ++ K RN+ + + ++N L++Y Sbjct: 76 KQLEINKLNRELKVLKEDYAKMIVKSYKSRNDQSRVMFVLSSQNFLQAY 124 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/64 (31%), Positives = 37/64 (57%) Frame = +1 Query: 49 TITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 228 T+ ND ++K+E+ER+ +K D+K+KE ++ K L+ TME ++L+ Sbjct: 3498 TVDND---ITKDELERL----KKIVENDEKEKENLKRK--LQG--SDSDGTMERKRLQRD 3546 Query: 229 ISDS 240 +SD+ Sbjct: 3547 MSDA 3550 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = +3 Query: 255 LDKCNDTIKWLDSN------QLADK-EEYEHKQKELEGI 350 +++C TIK LDSN Q+AD+ EE + ++ELE + Sbjct: 195 VNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESV 233 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 79 KEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDSDK 246 KE E +NE +KY N+ K +Q KNAL+ + S D L K + ++ Sbjct: 811 KERSEAWLNEKQKYTNDIKHIKTEVQLCKNALDGTKQKVLSLENDLLLTSKQLEKER 867 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = +1 Query: 19 EKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 198 E T+ N++ + KEE E +V + + RN+ K+ E ++++ L K Sbjct: 2523 EDLTSMVNELKEERRNEKQKKEEAEGLVEKLKVQRNQMIKEIEELKSEKGL----LEQKQ 2578 Query: 199 TMEDE--KLKEKI 231 M+DE KL+ +I Sbjct: 2579 QMQDEAQKLRNEI 2591 >SB_8472| Best HMM Match : TatC (HMM E-Value=1.4) Length = 476 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 334 KNWKAFTIR*LRRCTRVPEESPEVCRASRAEHPEPEVP 447 KN+ ++ L R P+E ++ SR PEP P Sbjct: 8 KNFDEVVVQLLMRMYEPPDEGSDIATFSRESDPEPNPP 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.128 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,320,784 Number of Sequences: 59808 Number of extensions: 340033 Number of successful extensions: 2040 Number of sequences better than 10.0: 89 Number of HSP's better than 10.0 without gapping: 1679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2011 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -