BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11024 (815 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22G7.08 |ppk8||serine/threonine protein kinase Ppk8 |Schizos... 26 5.6 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 25 9.7 >SPAC22G7.08 |ppk8||serine/threonine protein kinase Ppk8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 591 LLKIIQYLKYQLFIFIT 641 +L+II+Y+ Y LF FIT Sbjct: 316 ILQIIEYVPYDLFTFIT 332 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 25.4 bits (53), Expect = 9.7 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 689 TLIMLLSDKVLLWISYFLKVGTHCILLFLI*RCCQLLHCRLH 814 +L + L + + W+ YFL +G H +L ++ Q +H + H Sbjct: 196 SLAVALRTESVTWVRYFLLMGGHIVLAKIL----QAIHEKKH 233 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,964,104 Number of Sequences: 5004 Number of extensions: 57245 Number of successful extensions: 132 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -