BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11024 (815 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28260.2 68414.m03469 expressed protein 31 1.2 At1g28260.1 68414.m03468 expressed protein 31 1.2 >At1g28260.2 68414.m03469 expressed protein Length = 880 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 352 CSFLPMLIVLRGYFSFTLTCVGELTWLKPECRYTDPSKSSVRRIYHRI 209 C LP L+V Y F L V E + ECR+ + SKS++ + ++ Sbjct: 389 CPLLPALLVFLDYLPFLLDKVEEE---EEECRFDEKSKSAISYFFGKL 433 >At1g28260.1 68414.m03468 expressed protein Length = 880 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 352 CSFLPMLIVLRGYFSFTLTCVGELTWLKPECRYTDPSKSSVRRIYHRI 209 C LP L+V Y F L V E + ECR+ + SKS++ + ++ Sbjct: 389 CPLLPALLVFLDYLPFLLDKVEEE---EEECRFDEKSKSAISYFFGKL 433 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,001,647 Number of Sequences: 28952 Number of extensions: 281347 Number of successful extensions: 536 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -