BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11023 (782 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 27 4.0 SPAC17A5.06 |ptr8||transcription factor TFIIH complex ERCC-3 sub... 25 9.3 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 25 9.3 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 26.6 bits (56), Expect = 4.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 378 LKYIDNYQTNTVNQSYILFKNNHHLFVVW 292 LK + T QSY+ FKN+ +++ W Sbjct: 226 LKEVQEVYPATGGQSYLSFKNSEMMYLTW 254 >SPAC17A5.06 |ptr8||transcription factor TFIIH complex ERCC-3 subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 804 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/55 (23%), Positives = 27/55 (49%) Frame = -1 Query: 581 EHYVRWSNLKPHILTTYIRAHK**ITK*SERKALILFTTQISNRRARAILGQSKL 417 + +++WSN+KP + + HK SE ++ + ++N R R+ Q + Sbjct: 384 QQFLQWSNIKPDHIAVFTADHKERFH--SEAGVVVSTYSMVANTRNRSYDSQKMM 436 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 25.4 bits (53), Expect = 9.3 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 625 ICIESCKMIKSYFE*SIMLGGPT*SLTFLQPTL 527 +C+ +CK +SYF ++ + P L+ ++P L Sbjct: 691 VCVFTCKFAESYFFLTLSIRDPIIVLSTMRPYL 723 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,686,816 Number of Sequences: 5004 Number of extensions: 49618 Number of successful extensions: 109 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -