BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11023 (782 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_836| Best HMM Match : DUF82 (HMM E-Value=5.3) 29 5.6 >SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2956 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 161 KQFLNGHSHLSVSNRPSHHIATFLKRGIIITV 66 K FL + SV NR H+I L+RGI ++V Sbjct: 2678 KVFLKTEASFSVMNRTRHNILNMLRRGINVSV 2709 >SB_836| Best HMM Match : DUF82 (HMM E-Value=5.3) Length = 168 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +1 Query: 334 RLVYSIRLIIINILKFMTLPPFVFNTSANLDCPKIALARLLLIWVVNKIS 483 +L Y RLI ++ + P V T A++D P I L ++ V+N+++ Sbjct: 57 KLGYHHRLIPKSLASSLPKPILVRRTPASMDVPSIVLLQMCQTLVINELT 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,924,063 Number of Sequences: 59808 Number of extensions: 331053 Number of successful extensions: 495 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -