BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11021 (707 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0671 - 30769631-30769803,30770535-30770873,30770952-307710... 35 0.073 12_01_0125 - 946480-947242,947283-947374,947462-947680,948059-94... 30 1.6 11_01_0115 - 889159-889921,889962-890053,890141-890359,890738-89... 30 2.1 08_02_0997 + 23409932-23410894 28 8.4 05_01_0357 - 2802437-2802511,2802594-2802692,2803215-2803280,280... 28 8.4 01_01_0677 + 5201089-5201177,5201325-5202183,5202321-5202794 28 8.4 >02_05_0671 - 30769631-30769803,30770535-30770873,30770952-30771036, 30771229-30771369,30771802-30771873,30772183-30772302, 30772606-30772677,30772758-30772895,30773249-30773320, 30773609-30773685,30773761-30773837,30773960-30774077, 30774852-30774930 Length = 520 Score = 34.7 bits (76), Expect = 0.073 Identities = 18/60 (30%), Positives = 37/60 (61%) Frame = +2 Query: 329 SNLYETNILWTLFNGEAFDYIGSQRVAYDIKRGVWPPNAPLAPTDVKLHVEIGQIGGSLS 508 SNL + +++ +FNGEA+ Y+GS++ ++ +G N ++ + +EIG +G ++S Sbjct: 206 SNL-KKQLVFAVFNGEAWGYLGSRKFLQELDQGADSVNG-ISSLLIDQVLEIGSVGKAIS 263 >12_01_0125 - 946480-947242,947283-947374,947462-947680,948059-949156 Length = 723 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/62 (24%), Positives = 36/62 (58%) Frame = +3 Query: 60 NTEVCMRRSATSTIVTTTKVCDPLGDQNVYYSLFPRTKESKKQSITLVTARIDSASLFDG 239 NT++ + S S + + +K +PL +++ +++ T + KK + ++ T R ++AS + Sbjct: 477 NTQLAIVHSKFSELTSASKTSNPLPTVDIFLAVYEDTLKWKKIAESISTNRTETASWENS 536 Query: 240 VS 245 V+ Sbjct: 537 VT 538 >11_01_0115 - 889159-889921,889962-890053,890141-890359,890738-891835 Length = 723 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/56 (25%), Positives = 33/56 (58%) Frame = +3 Query: 60 NTEVCMRRSATSTIVTTTKVCDPLGDQNVYYSLFPRTKESKKQSITLVTARIDSAS 227 NT++ + S S + + +K +PL +++ +++ T + KK + ++ T R ++AS Sbjct: 477 NTQLAIVHSKFSELTSASKTSNPLPTVDIFLAVYEDTLKWKKIAESISTNRTETAS 532 >08_02_0997 + 23409932-23410894 Length = 320 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 524 FSFT*LIRIHRSGRFQRVVLHRSVPAVHSAAT 429 F F LIR +RSGR R++ VP AAT Sbjct: 10 FEFLPLIRCYRSGRVDRLLPDTRVPPSVDAAT 41 >05_01_0357 - 2802437-2802511,2802594-2802692,2803215-2803280, 2803619-2803665,2804067-2804133,2805062-2805283 Length = 191 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 689 LNECIDDVGREPLKIPGIVMLYAFDNCFRKICISL 585 L+ + D+GR+PLK V++ A NC +++C L Sbjct: 117 LDRVVADLGRKPLK----VLVQALANCRKEVCKEL 147 >01_01_0677 + 5201089-5201177,5201325-5202183,5202321-5202794 Length = 473 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 565 STINDGDNDIQIFLKQLSNAYNMTIPGIFNGSLPTSSIHSFR 690 S + DG + + + L S+ ++ G F S PTSS SFR Sbjct: 98 SAVYDGASMVDVLLMASSSPHHHAGAGSFQYSSPTSSSASFR 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,970,160 Number of Sequences: 37544 Number of extensions: 390932 Number of successful extensions: 861 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -