BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11020 (809 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3E7.16c |leu3|SPBC4F6.03c|2-isopropylmalate synthase|Schizos... 30 0.34 SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosac... 26 7.3 SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 25 9.6 SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomy... 25 9.6 SPAC3F10.15c |spo12||Spo12 family protein|Schizosaccharomyces po... 25 9.6 >SPBC3E7.16c |leu3|SPBC4F6.03c|2-isopropylmalate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 30.3 bits (65), Expect = 0.34 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +2 Query: 311 IPVSKSNLYETNILWTLFNGEAFDYIGSQRVAYDIKRGVWP----PNAPLAPTDV 463 I V + Y N+++T F+G D I AYD ++ V P P PL P DV Sbjct: 335 INVHPRHPYAGNLVFTAFSGSHQDAISKGLKAYDERKAVDPVWKVPYLPLDPHDV 389 >SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.8 bits (54), Expect = 7.3 Identities = 16/68 (23%), Positives = 31/68 (45%) Frame = +1 Query: 511 VNENTWPLNAFVPTLAPSTINDGDNDIQIFLKQLSNAYNMTIPGIFNGSLPPSSIHSFRR 690 +++N +P ++F + + + G NDI+ + N Y ++ + PSS S Sbjct: 139 LSDNLFPGSSFSASSQQNPSSPGSNDIKSEFAAVKNEYVLSPTSPTTSAAFPSSFSSLPL 198 Query: 691 ILSNVTET 714 + S T T Sbjct: 199 VSSKPTGT 206 >SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 689 Score = 25.4 bits (53), Expect = 9.6 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 118 AIRLAIKTFIIPFSLERKNLRSSPSRW*LQGSIQLLYLMGCLRVLLFCRR 267 A RL +K+F PF LER +L + + G + + L+ L FC R Sbjct: 442 ANRLFLKSFAHPFHLERYHLHAVAA----MGGLYQIMSSTHLKNLFFCSR 487 >SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 25.4 bits (53), Expect = 9.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 53 NKYRSLHEKVSYLNDSN 103 N+Y+ L EK Y NDSN Sbjct: 246 NRYKELEEKRRYENDSN 262 >SPAC3F10.15c |spo12||Spo12 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 90 Score = 25.4 bits (53), Expect = 9.6 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 641 ESLMALCHRHLYIHSEEYYPM*QKPVICLK 730 +SLM+ C L H ++YY + PV+ L+ Sbjct: 50 DSLMSPCTAKLQAHKKKYYMKRKPPVMSLQ 79 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,356,380 Number of Sequences: 5004 Number of extensions: 70299 Number of successful extensions: 185 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 394431430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -