BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11020 (809 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39236| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_59050| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6508| Best HMM Match : AMP-binding (HMM E-Value=2.8026e-45) 30 1.9 SB_39599| Best HMM Match : Extensin_2 (HMM E-Value=0.09) 30 2.6 SB_31702| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-05) 28 7.8 >SB_39236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 68.9 bits (161), Expect = 5e-12 Identities = 33/79 (41%), Positives = 48/79 (60%) Frame = +3 Query: 15 LCSIQLNSFMFAAINTEVCMRRSATSTIVTTTKVCDPLGDQNVYYSLFPRTKESKKQSIT 194 LCS QL FMFAA +T CMR++ T CDPLGD N++ +L+P + ++ I Sbjct: 18 LCSAQLKDFMFAAKDTPTCMRKTNIPN-PTQNMFCDPLGDLNIWSTLYPMNRTPNEKEIV 76 Query: 195 LVTARIDSASLFDGVSPGA 251 +V A++DS+S F + GA Sbjct: 77 VVAAKMDSSSFFHDLVYGA 95 >SB_59050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 371 EAFDYIGSQRVAYDIKRGVWPPNAPLAPTD 460 E++DYIGS R+ Y++++G++PPN P D Sbjct: 1 ESWDYIGSSRMVYEMEQGLFPPNPWKVPGD 30 >SB_6508| Best HMM Match : AMP-binding (HMM E-Value=2.8026e-45) Length = 1038 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = -1 Query: 695 NILLNECIDDGGREPLKIPGIVMLYAFDNCFRKICIS-----LSPSFIVDGARVGTK-AF 534 N +LN + R P+ + L+ D F+K + PSF+VD A +G K Sbjct: 685 NHVLNRVVFSFARLPMPPGTMGTLWRADERFKKTYFEKYPGMMKPSFVVDAACIGLKDGI 744 Query: 533 KGHV 522 KGHV Sbjct: 745 KGHV 748 >SB_39599| Best HMM Match : Extensin_2 (HMM E-Value=0.09) Length = 564 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +1 Query: 520 NTWPLNAFVPTLAPSTINDGDNDIQIFLKQLSNAYNMTIPGIFNGSLPPSSIHSFR 687 ++W NA PT + + DG + + L PG+ S PP SIH R Sbjct: 111 SSWLANAPYPTPLDTPLTDGAPGLSMHPTPLDTRVTDGAPGLPMHSTPPLSIHESR 166 >SB_31702| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-05) Length = 364 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 Query: 651 IKDSGYCHVICIRQLFQEDLYIIITVIY 568 I+D+ + VIC+ LF +YI+I V++ Sbjct: 281 IRDTKHATVICLVTLFHFTVYIVIAVLF 308 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,599,560 Number of Sequences: 59808 Number of extensions: 543447 Number of successful extensions: 1185 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -