BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11019 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16780.1 68416.m02142 60S ribosomal protein L19 (RPL19B) simi... 128 2e-30 At1g02780.1 68414.m00233 60S ribosomal protein L19 (RPL19A) simi... 126 9e-30 At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) simi... 126 2e-29 At4g16030.1 68417.m02432 60S ribosomal protein L19, putative sim... 46 3e-05 At1g26720.1 68414.m03254 expressed protein ; expression supporte... 30 1.1 At3g16730.1 68416.m02136 expressed protein ; expression supporte... 29 2.6 At3g30842.1 68416.m03968 ABC transporter protein, putative simil... 29 3.5 At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p... 28 6.1 At5g04710.1 68418.m00480 aspartyl aminopeptidase, putative simil... 28 6.1 At3g27260.1 68416.m03407 DNA-binding bromodomain-containing prot... 28 6.1 At2g25320.1 68415.m03029 meprin and TRAF homology domain-contain... 28 6.1 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 28 6.1 At3g04340.1 68416.m00459 FtsH protease family protein similar to... 27 8.0 >At3g16780.1 68416.m02142 60S ribosomal protein L19 (RPL19B) similar to ribosomal protein L19 GB:CAA45090 from [Homo sapiens] Length = 209 Score = 128 bits (310), Expect = 2e-30 Identities = 56/83 (67%), Positives = 69/83 (83%) Frame = +1 Query: 7 MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 186 M SLK+QKRLAASVM+CGK KVWLDPNE +I+ NSRQNIRK++KDG +I+KP +HSR Sbjct: 1 MVSLKIQKRLAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSR 60 Query: 187 ARVRKNTEARRKGRHCGFGKRRG 255 +R R EA+RKGRH G+GKR+G Sbjct: 61 SRARALNEAKRKGRHSGYGKRKG 83 Score = 99 bits (238), Expect = 1e-21 Identities = 51/93 (54%), Positives = 59/93 (63%) Frame = +3 Query: 249 KRTANARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 428 K T AR+P K LW +KKIDRH+YH +YMK KGNVFKNKRVLME Sbjct: 82 KGTREARLPTKILWMRRMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMES 141 Query: 429 IHRKKAEKARTKMLSDQAEARRNKVKEHASAAR 527 IH+ KAEKAR K L+DQ EA+R +K AS R Sbjct: 142 IHKMKAEKAREKTLADQFEAKR--IKNKASRER 172 >At1g02780.1 68414.m00233 60S ribosomal protein L19 (RPL19A) similar to ribosomal protein L19 GI:36127 from [Homo sapiens] Length = 214 Score = 126 bits (305), Expect = 9e-30 Identities = 56/83 (67%), Positives = 69/83 (83%) Frame = +1 Query: 7 MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 186 M SLKLQKRLAASVM+CGK KVWLDPNE ++I+ NSRQNIRK++KDG +I+KP +HSR Sbjct: 1 MVSLKLQKRLAASVMKCGKGKVWLDPNESSDISMANSRQNIRKLVKDGFIIRKPTKIHSR 60 Query: 187 ARVRKNTEARRKGRHCGFGKRRG 255 +R RK A+ KGRH G+GKR+G Sbjct: 61 SRARKMKIAKMKGRHSGYGKRKG 83 Score = 99.1 bits (236), Expect = 2e-21 Identities = 48/86 (55%), Positives = 55/86 (63%) Frame = +3 Query: 249 KRTANARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 428 K T AR+P K LW KKID+H+YH +YM+ KGNVFKNKRVLME Sbjct: 82 KGTREARLPTKVLWMRRMRVLRRLLKKYRETKKIDKHMYHDMYMRVKGNVFKNKRVLMES 141 Query: 429 IHRKKAEKARTKMLSDQAEARRNKVK 506 IH+ KAEKAR K LSDQ EA+R K K Sbjct: 142 IHKSKAEKAREKTLSDQFEAKRAKNK 167 >At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) similar to L19 from several species Length = 208 Score = 126 bits (303), Expect = 2e-29 Identities = 54/83 (65%), Positives = 71/83 (85%) Frame = +1 Query: 7 MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 186 M SLKLQKRLA+SV++CGK+KVWLDPNE ++I+ NSRQNIRK++KDG +I+KP +HSR Sbjct: 1 MVSLKLQKRLASSVLKCGKRKVWLDPNEGSDISMANSRQNIRKLVKDGFIIRKPTKIHSR 60 Query: 187 ARVRKNTEARRKGRHCGFGKRRG 255 +R R+ A+RKGRH G+GKR+G Sbjct: 61 SRARQLNIAKRKGRHSGYGKRKG 83 Score = 101 bits (242), Expect = 4e-22 Identities = 50/86 (58%), Positives = 55/86 (63%) Frame = +3 Query: 249 KRTANARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 428 K T AR+P K LW KKIDRH+YH +YMK KGNVFKNKRVLME Sbjct: 82 KGTREARLPTKVLWMRRMRVLRRLLKKYRETKKIDRHMYHDMYMKVKGNVFKNKRVLMES 141 Query: 429 IHRKKAEKARTKMLSDQAEARRNKVK 506 IH+ KAEKAR K LSDQ EA+R K K Sbjct: 142 IHKSKAEKAREKTLSDQFEAKRAKNK 167 >At4g16030.1 68417.m02432 60S ribosomal protein L19, putative similar to 60S ribosomal protein L19-3 (Swiss-Prot:P49693) [Arabidopsis thaliana] Length = 101 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 342 KKIDRHLY-HSLYMKAKGNVFKNKRVLMEYIHRKKAEK 452 KKID+ +Y H ++MK KG V+KNK VLME +H+ E+ Sbjct: 29 KKIDKLVYYHDMFMKVKGKVYKNKCVLMESMHKSSRER 66 >At1g26720.1 68414.m03254 expressed protein ; expression supported by MPSS Length = 169 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 118 RQNIRKMIKDGLVIKKPV-AVHSRARVRKNTEARRKGRHCGFGKRRGQPM 264 R+N++ + D L KPV A RA + NTEAR G G+ Q M Sbjct: 26 RKNLQDKLGDTLFASKPVEATELRAALVSNTEARDISGSIGLGEVGSQEM 75 >At3g16730.1 68416.m02136 expressed protein ; expression supported by MPSS Length = 695 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +3 Query: 429 IHRKKAEKARTKMLSDQAEARRNKVKEHASAARNVLPPRRRNCCRPSLEKTKPRLPL 599 +H +K EK + +A++ K K H S PP++RN C S + K L + Sbjct: 603 VHNRKNEKRGIHLPQKRAKSPITKGKSHESP-----PPKKRNTCSVSSQTRKVSLKI 654 >At3g30842.1 68416.m03968 ABC transporter protein, putative similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1406 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/24 (37%), Positives = 19/24 (79%) Frame = -1 Query: 478 WSLSIFVLAFSAFFLWMYSMSTRL 407 W +S+ ++AFS FF+++Y+ S ++ Sbjct: 1377 WVVSLTLIAFSMFFVFIYAFSVKI 1400 >At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol protease, putative similar to cysteine proteinase RD21A precursor (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 463 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 167 GFLMTRPSLIILRMFCLELVFAISLISFGSNH 72 GFL P +++L M + +S+IS+ NH Sbjct: 2 GFLKLSPMILLLAMIGVSYAMDMSIISYDENH 33 >At5g04710.1 68418.m00480 aspartyl aminopeptidase, putative similar to SP|Q9ULA0 Aspartyl aminopeptidase (EC 3.4.11.21) {Homo sapiens}; contains Pfam profile PF02127: Aminopeptidase I zinc metalloprotease (M18) Length = 526 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 83 GSNHTFFLPHRITEAASLFCSLRELI 6 G+N+ F R+ AS FC+LR LI Sbjct: 298 GANNEFIFSGRLDNLASSFCALRALI 323 >At3g27260.1 68416.m03407 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 813 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +3 Query: 387 KGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEHASAARNVLPPRRR 551 KG+ + ++ E + +KK EKAR + ++ AE R + + A+A R+R Sbjct: 562 KGDPERLRKEREELVLQKKKEKARLQAEAEAAEDARRQAEAEAAAEAAAEAKRKR 616 >At2g25320.1 68415.m03029 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1663 Score = 27.9 bits (59), Expect = 6.1 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 497 IAAGLSLVAKHLRPGLLSLLPVDVLH-EHTLVLEHITLRL 381 IA L KHL+P L+SL+P V H EH L + RL Sbjct: 974 IALVLDRAPKHLQPDLVSLVPKLVEHSEHPLAALALIERL 1013 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 145 DGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRR 252 D + KK + + + ++RKN + RR+G G G RR Sbjct: 77 DVIYWKKLLELENSGKIRKNPKPRRRGDKSGDGFRR 112 >At3g04340.1 68416.m00459 FtsH protease family protein similar to chloroplast FtsH protease [Arabidopsis thaliana] GI:1483215; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 960 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 339 AKKIDRHLYHSLYMKAKGNVFKNKRVL 419 A K+++ +Y Y KAKG + KN+RVL Sbjct: 870 AGKVEK-IYDLAYEKAKGMLLKNRRVL 895 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,481,007 Number of Sequences: 28952 Number of extensions: 277649 Number of successful extensions: 880 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -