BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11018 (776 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC725.06c |ppk31|mug25|serine/threonine protein kinase Ppk31 |... 27 4.0 SPBC1709.06 |dus2||tRNA dihydrouridine synthase Dus2 |Schizosacc... 26 5.2 >SPBC725.06c |ppk31|mug25|serine/threonine protein kinase Ppk31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1032 Score = 26.6 bits (56), Expect = 4.0 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 477 ENLFGTDCLVISVKIFLVCINIHHKNYVVRQVKFANFQ*SNTYMK 343 +NLF V V FL C I NY ++Q K A F+ TY++ Sbjct: 66 DNLFRKSISVAHVFAFLRCNPIRSPNYYIQQAK-APFE-GKTYIR 108 >SPBC1709.06 |dus2||tRNA dihydrouridine synthase Dus2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 26.2 bits (55), Expect = 5.2 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -3 Query: 315 ITSFQIE--LSSKRYSMEYRKIETKIDYFFHFVLYCLSQ 205 ++ F+IE LSS + + E+ K+ ++D F YCL+Q Sbjct: 252 VSCFRIEGPLSSFKVAEEFLKMALEVDNNFGNTKYCLNQ 290 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,284,785 Number of Sequences: 5004 Number of extensions: 70274 Number of successful extensions: 149 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -