BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11018 (776 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2623|AAN10906.1| 294|Drosophila melanogaster CG31827-P... 30 4.1 AE014134-2620|AAG22434.1| 294|Drosophila melanogaster CG18478-P... 30 4.1 >AE014134-2623|AAN10906.1| 294|Drosophila melanogaster CG31827-PA protein. Length = 294 Score = 29.9 bits (64), Expect = 4.1 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +3 Query: 168 YKFNEGFIHEYTLAKDSKVQSGRNNL-FLFLFYDIP----SNSVCSTTQ 299 Y F E F+ + + K Q G NNL LFL + P N++C TQ Sbjct: 110 YPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQ 158 >AE014134-2620|AAG22434.1| 294|Drosophila melanogaster CG18478-PA protein. Length = 294 Score = 29.9 bits (64), Expect = 4.1 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +3 Query: 168 YKFNEGFIHEYTLAKDSKVQSGRNNL-FLFLFYDIP----SNSVCSTTQ 299 Y F E F+ + + K Q G NNL LFL + P N++C TQ Sbjct: 110 YPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQ 158 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,636,841 Number of Sequences: 53049 Number of extensions: 690335 Number of successful extensions: 1057 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -