BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11012 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58279| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_30565| Best HMM Match : Metallothio (HMM E-Value=1.8) 30 1.7 SB_20479| Best HMM Match : Collagen (HMM E-Value=1) 29 3.0 SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13) 29 5.3 SB_58665| Best HMM Match : TSP_1 (HMM E-Value=7.5e-10) 29 5.3 SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) 29 5.3 SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) 29 5.3 SB_28756| Best HMM Match : C1_4 (HMM E-Value=0.095) 28 7.0 SB_31229| Best HMM Match : TP2 (HMM E-Value=1.7) 28 9.3 SB_5030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34777| Best HMM Match : VWA (HMM E-Value=0) 28 9.3 SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_58279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 91.1 bits (216), Expect = 9e-19 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +3 Query: 255 ATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 389 ATVG AGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 111 ATVGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSE 155 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +1 Query: 106 SALVRPLAAVPTHTQMVPAVPTQLS-AVRSFQTTSVTKDIDSAAKFIGAGA 255 +A +RP + +VPA P + A R FQT+S +D+DSAAKFIGAGA Sbjct: 61 TAAIRPQSQALVKA-VVPASPLLGALASRGFQTSSAVQDVDSAAKFIGAGA 110 >SB_30565| Best HMM Match : Metallothio (HMM E-Value=1.8) Length = 565 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 240 EFGSRVNVLSDRCGLEGPHCR-ELCRDSRYHLCMGG 136 E R NVLSD GLE CR LC + + C G Sbjct: 76 EASQRCNVLSDAPGLETESCRCTLCDERGFSACRSG 111 >SB_20479| Best HMM Match : Collagen (HMM E-Value=1) Length = 1214 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -1 Query: 470 VVVFLKVNSLESEEQQERHHKTEQTHSLRQGETQNG 363 +V LK ESEE E H EQ H +Q +T NG Sbjct: 208 LVPSLKKPRCESEEDDEEEHDLEQCHD-QQKDTSNG 242 >SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5834 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 201 GLEGPHCRELCRDSRYHLCMG-GYCCKWSHQC 109 G G C +LC+ +++C G G C +W+ C Sbjct: 5392 GYWGEDCGKLCKGGIWNVCNGHGTCNRWTGDC 5423 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 201 GLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGR-PGCRGDQSGGRQ 52 G + P E CR + C C +++HQC E+G P S GR+ Sbjct: 365 GRDRPTSSEACRSWNFAKCFFPGC-RYTHQCAYCENGNYPARECPSSAGRK 414 >SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13) Length = 186 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 110 HWCDHLQQYPPIHRWY-LLSLHSSLQCGPSRPHRSLRTL 223 HW + + PI RW+ L H+SL P+RP+R+ + + Sbjct: 129 HWNEAMTAKKPIARWHSLREFHNSLL--PTRPNRTSKPI 165 >SB_58665| Best HMM Match : TSP_1 (HMM E-Value=7.5e-10) Length = 718 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 42 KQNAVCRQTDRPCSQVCHLLQLCTGATTCSSTHPYTDGTCCPYTALCSAVLPD 200 ++ VC TD+PC + H ++ C T +T P T C T S +PD Sbjct: 489 RRERVCSDTDKPCQGLDHEVRECQ-VTRPDTTTPTMPTTLC--TIHYSQXVPD 538 >SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) Length = 351 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 123 TCSSTHPYTDGTCCPYTALCSAV 191 +CSS H DGTC ++ C+ V Sbjct: 111 SCSSRHACADGTCVTWSLTCNGV 133 >SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = -3 Query: 249 STNEFGSRVNVLS-DRCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRG 73 ST E +R+ ++S D+C + CR+ C+ S + MG C + + + ++A P C G Sbjct: 8 STQEKLTRIAIVSTDKC--KPKRCRQECKKSCPVVRMGKLCIEVTPETKLAAISEPLCIG 65 >SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) Length = 147 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 123 TCSSTHPYTDGTCCPYTALCSAV 191 +CSS H DGTC ++ C+ V Sbjct: 111 SCSSRHACADGTCVTWSLTCNGV 133 >SB_28756| Best HMM Match : C1_4 (HMM E-Value=0.095) Length = 201 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 180 RELCRDSRYHLCMGGYCCKWSHQCR 106 R CR HLC+G C+W Q R Sbjct: 173 RNGCRKCDVHLCVGDCFCEWHQQRR 197 >SB_31229| Best HMM Match : TP2 (HMM E-Value=1.7) Length = 676 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 397 VCSVL*WRSCCSSLSKLFTFKNTTTAILHMRFQCILSEWTAM 522 VC+ + W++ SL+K L +FQC +SEW ++ Sbjct: 337 VCAGV-WKTGTKSLTKALRILGYRVYDLDEQFQCFMSEWESL 377 >SB_5030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 7/34 (20%) Frame = +2 Query: 263 GSSWFRSWYWNSLR--LPHH-----RLCQEPLPQ 343 G +WF SW W + LPH+ + C E LP+ Sbjct: 261 GENWFLSWIWPKITSPLPHNGTDYTQACNEELPK 294 >SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = -3 Query: 183 CRELCRDSRYHLCMGGYCCKWSHQC---RVAEDG--RPGCRGDQSG 61 C C Y C+ G C KW C + EDG PG G Q G Sbjct: 1189 CDHKCSKDEYQ-CVSGACVKWPLTCDGKKDCEDGTDEPGICGVQIG 1233 >SB_34777| Best HMM Match : VWA (HMM E-Value=0) Length = 1268 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = -1 Query: 440 ESEEQQERHHKTEQTHSLR----QGETQNGV*EQLLLEGGVPGIADDEGAE 300 + + QER +TEQTH QG+ Q +Q ++G G + D+G E Sbjct: 636 DQNQTQERQGQTEQTHGPDPGEVQGQEQGQGQDQSHVQGQEEGHSQDQGQE 686 >SB_30175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 458 LKVNSLESEEQQERHHKTEQTHSLRQGETQN 366 LK E E+QQ +HHK E+ Q E Q+ Sbjct: 426 LKHQKQEEEQQQLQHHKQEEEQLKHQQEQQH 456 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,718,302 Number of Sequences: 59808 Number of extensions: 590017 Number of successful extensions: 1960 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1951 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -